Reactivity | RtSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE. The peptide sequence for this immunogen was taken from within the described region. |
Marker | Intercellular Junctions/Tight Junction Marker |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TJP1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 190 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Publication using NBP1-91621 | Applications | Species |
---|---|---|
Tsuda A, Donaghey TC, Konduru NV, et al. Age-Dependent Translocation of Gold Nanoparticles across the Air-Blood Barrier ACS Nano 2019-09-24 [PMID: 31397554] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Zonula Occludens (ZO) the Junction Scaffolding Proteins The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TJP1 |
Uniprot |
|