![Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Effect of TBeta4 on primary cilia formation in HeLa cells.The mRNA (upper) and protein (lower) expression of TBeta4 were shown. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-43235-1) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Thymosin-beta-4-Antibody-Western-Blot-H00007114-B01P-img0005.jpg "Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Effect of TBeta4 on primary cilia formation in HeLa cells.The mRNA (upper) and protein (lower) expression of TBeta4 were shown. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-43235-1) licensed under a CC-BY license.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | TMSB4X (AAH01631.1, 1 a.a. - 44 a.a.) full-length human protein. MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Specificity | TMSB4X - thymosin, beta 4, X-linked, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TMSB4X |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00007114-B01P | Applications | Species |
|---|---|---|
| Lee JW, Kim HS, Moon EY Thymosin beta-4 is a novel regulator for primary cilium formation by nephronophthisis 3 in HeLa human cervical cancer cells Sci Rep 2019-05-02 [PMID: 31048733] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Thymosin beta 4 Antibody (H00007114-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMSB4X |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of purified antibody to TMSB4X on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/Thymosin-beta-4-Antibody-Immunocytochemistry-Immunofluorescence-H00007114-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of purified antibody to TMSB4X on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of TMSB4X expression in transfected 293T cell line by TMSB4X polyclonal antibody. Lane 1: TMSB4X transfected lysate(4.84 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Thymosin-beta-4-Antibody-Western-Blot-H00007114-B01P-img0004.jpg "Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of TMSB4X expression in transfected 293T cell line by TMSB4X polyclonal antibody. Lane 1: TMSB4X transfected lysate(4.84 KDa). Lane 2: Non-transfected lysate.")
![Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - No effect of T beta 4 on upstream-deleted mutant of NPHP3-promoter (pmt.). (a) Mutant (mt.) NPHP3-promoter plasmids were prepared from wildtype (wt.) promoter. (b–e) HeLa cells were transfected with pCMV-2B or pCMV-T beta 4 for 24 h. (b) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-NPHP3-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of NPHP3-promoter activity. (c) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. (d) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). (e) The ciliated cells in pCMV-2B- (white) or pCMV-T beta 4-transfected group (grey) were counted. (f) Mutant (mt.) T beta 4-promoter plasmids were prepared from wildtype (wt.) promoter. (g,h) HeLa cells were transfected with pCDNA3.1 or pCDNA6-NPH3 for 24 h. (g) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-T beta 4-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of T beta 4-promoter activity. (h) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image (c,d & h). Data in a bar graph represent the means ± SEM. **p 500 cells). (e,f) Cells were transfected with pEGFP-2B or pEGFP-T beta 4 plasmid for 24 h. (e) The expression of GFP & T beta 4-GFP were detected with GFP antibody. (f) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). The ciliated cells in GFP (white) or T beta 4-GFP-positive cells (grey) were counted. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image. Data in a bar graph represent the means ± SEM. **p < 0.01; significantly different from control cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31048733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007114-b01p_mouse-polyclonal-thymosin-beta-4-antibody-310202415483649.jpg "Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - No effect of T beta 4 on upstream-deleted mutant of NPHP3-promoter (pmt.). (a) Mutant (mt.) NPHP3-promoter plasmids were prepared from wildtype (wt.) promoter. (b–e) HeLa cells were transfected with pCMV-2B or pCMV-T beta 4 for 24 h. (b) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-NPHP3-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of NPHP3-promoter activity. (c) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. (d) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). (e) The ciliated cells in pCMV-2B- (white) or pCMV-T beta 4-transfected group (grey) were counted. (f) Mutant (mt.) T beta 4-promoter plasmids were prepared from wildtype (wt.) promoter. (g,h) HeLa cells were transfected with pCDNA3.1 or pCDNA6-NPH3 for 24 h. (g) HeLa cells were co-transfected with wildtype or mutant pEZX-PG02-T beta 4-promoter Gluc plasmid. & Gluc activity in cultured media was measured with luminometer using Gluc substrate. Bar graph indicates the mean of T beta 4-promoter activity. (h) Expression level of T beta 4 & NPHP3 transcripts were measured by RT-PCR. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image (c,d & h). Data in a bar graph represent the means ± SEM. **p 500 cells). (e,f) Cells were transfected with pEGFP-2B or pEGFP-T beta 4 plasmid for 24 h. (e) The expression of GFP & T beta 4-GFP were detected with GFP antibody. (f) The cells were fixed & stained with antibody against Ac-tubulin (red) & DAPI (blue). The ciliated cells in GFP (white) or T beta 4-GFP-positive cells (grey) were counted. Processing (such as changing brightness & contrast) is applied equally to controls across the entire image. Data in a bar graph represent the means ± SEM. **p < 0.01; significantly different from control cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31048733), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![N/A TFPI [HRP]](https://images.novusbio.com/images2/DATA_TFPI_DTFP10_ELISA_841.jpg)
![N/A TFPI [HRP]](https://images.novusbio.com/images2/TFPI_DTFP10_ELISA_190.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")