Novus Biologicals products are now on bio-techne.com

TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free

Name: TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free
Brand: Novus Biologicals
SKU: H00060436-M01
Price: 499 USD

Submit a Review

Images

(

Enlarge)

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - TGIF2 monoclonal antibody (M01), clone 4C10. Analysis of TGIF2 expression in A-431.

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - Analysis of TGIF2 over-expressed 293 cell line, cotransfected with TGIF2 Validated Chimera RNAi ( Cat # H00060436-R01V ) (Lane 2) or ...read more

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - TGIF2 monoclonal antibody (M01), clone 4C10. Analysis of TGIF2 expression in IMR-32.

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - TGIF2 monoclonal antibody (M01), clone 4C10. Analysis of TGIF2 expression in SW-13.

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - TGIF2 monoclonal antibody (M01), clone 4C10 Analysis of TGIF2 expression in Hela S3 NE.

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - TGIF2 monoclonal antibody (M01), clone 4C10. Analysis of TGIF2 expression in Y-79.

Western Blot: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - Analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody (M01), clone 4C10.Lane 1: TGIF2 transfected lysate(25.9 ...read more

Sandwich ELISA: TGF beta induced factor 2 Antibody (4C10) [H00060436-M01] - Detection limit for recombinant GST tagged TGIF2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, KD
Clone	4C10
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated
Format	Azide and BSA Free

Order Details

Novus Biologicals offers 100% Guarantee

TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free Summary

Immunogen	TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Specificity	TGIF2 - TGFB-induced factor 2 (TALE family homeobox)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	TGIF2
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Knockdown Validated Sandwich ELISA Western Blot 1:500
Application Notes	Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free

homeobox protein TGIF2
TGF(beta)-induced transcription factor 2
TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2
TGFB-induced factor 2 (TALE family homeobox)
TGFB-induced factor 2
TGFB-induced factor homeobox 2
transcription growth factor-beta-induced factor 2

Background

The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TGIF1 Antibody
(790707)

MAB7555

(1 Publication)

Species: Hu

Applications: Simple Western, WB

IL-10 [Biotin]

DY417

(306 Publications)

Species: Mu

Applications: ELISA

TGIF2LX Antibody -
BSA Free

NBP1-86320

Immunohistochemistry TGIF2LX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence TGIF2LX Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Aurora A Antibody
- BSA Free

NBP1-51843

Immunocytochemistry/ Immunofluorescence Aurora A Antibody - BSA Free

Simple Western Aurora A Antibody - BSA Free

(1 Review)

(7 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(48 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

TGF-beta 1
[Unconjugated]

7754-BH/CF

(53 Publications)

Species: Hu

Applications: BA

Sonic Hedgehog/Shh
[Unconjugated]

464-SH

SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]

SEC-MALS Sonic Hedgehog/Shh [Unconjugated]

(70 Publications)

Species: Mu

Applications: BA

VEGF [HRP]

DVE00

(686 Publications)

Species: Hu

Applications: ELISA

ZNF217 Antibody
(OTI3G5)

NBP2-46424

Immunohistochemistry-Paraffin ZNF217 Antibody (OTI3G5)

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

CtBP1 Antibody
(2G7) - Azide and BSA ...

H00001487-M01

Immunocytochemistry/ Immunofluorescence CtBP1 Antibody (2G7) - Azide and BSA Free

Immunohistochemistry-Paraffin CtBP1 Antibody (2G7) - Azide and BSA Free

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Histone
Deacetylase 4/HDAC4 A ...

NBP2-22151

Western Blot Histone Deacetylase 4/HDAC4 Antibody - BSA Free

(5 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

E2F3 Antibody -
BSA Free

NBP1-80295

(1 Publication)

Species: Hu, Mu

Applications: WB

ELSPBP1 Antibody -
BSA Free

NBP2-13957

Immunohistochemistry-Paraffin ELSPBP1 Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

Cdk6 Antibody
(8H4) - Azide and BSA ...

H00001021-M01

Proximity Ligation Assay Cdk6 Antibody (8H4) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence Cdk6 Antibody (8H4) - Azide and BSA Free

(4 Publications)

Species: Hu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB

NCOA3/AIB1
Antibody - BSA Free

NB100-314

(1 Review)

(4 Publications)

Species: Hu

Applications: IP, WB

PTP1B/PTPN1
Antibody [Unconjugate

AF3954

Simple Western PTP1B/PTPN1 Antibody [Unconjugated]

(14 Publications)

Species: Mu, Rt

Applications: Simple Western, WB

HDAC1 Antibody -
BSA Free

NB100-56340

Simple Western HDAC1 Antibody - BSA Free

(2 Reviews)

(19 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Nodal
[Unconjugated]

3218-ND

(22 Publications)

Species: Hu

Applications: BA

TGIF2LY Antibody -
BSA Free

NBP3-10391

Species: Hu

Applications: WB

TGF beta induced
factor 2 Antibody (4C ...

H00060436-M01

Species: Hu

Applications: WB, ELISA, KD

Publications for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

There are no publications for TGF beta induced factor 2 Antibody (H00060436-M01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

There are no reviews for TGF beta induced factor 2 Antibody (H00060436-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional TGF beta induced factor 2 Products

Research Areas for TGF beta induced factor 2 Antibody (H00060436-M01)

Find related products by research area.

Blogs on TGF beta induced factor 2

There are no specific blogs for TGF beta induced factor 2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol	TGIF2
Entrez	60436(Human)
OMIM	607294(Human)
Uniprot	NP_068581(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free

Species Glossary

Images

Product Details

Order Details

TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for TGF beta induced factor 2 Antibody (4C10) - Azide and BSA Free

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

Reviews for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

Product General Protocols

Video Protocols

FAQs for TGF beta induced factor 2 Antibody (H00060436-M01) (0)

Secondary Antibodies

Isotype Controls

Additional TGF beta induced factor 2 Products

Research Areas for TGF beta induced factor 2 Antibody (H00060436-M01)

Blogs on TGF beta induced factor 2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics