![Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining in human gallbladder and pancreas tissues using anti-GTF2B antibody. Corresponding GTF2B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TFIIB-Antibody-Immunohistochemistry-Paraffin-NBP2-34143-img0011.jpg "Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining in human gallbladder and pancreas tissues using anti-GTF2B antibody. Corresponding GTF2B RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFG |
| Predicted Species | Mouse (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GTF2B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TFIIB Antibody (NBP2-34143)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TFIIB Antibody [NBP2-34143] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GTF2B antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/TFIIB-Antibody-Western-Blot-NBP2-34143-img0013.jpg "Western Blot: TFIIB Antibody [NBP2-34143] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GTF2B antibody. Remaining relative intensity is presented.")
![Immunocytochemistry/Immunofluorescence: TFIIB Antibody [NBP2-34143] - Staining of human cell line HEK 293 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TFIIB-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34143-img0008.jpg "Immunocytochemistry/Immunofluorescence: TFIIB Antibody [NBP2-34143] - Staining of human cell line HEK 293 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining of human gallbladder shows high expression.](http://images.novusbio.com/fullsize/TFIIB-Antibody-Immunohistochemistry-Paraffin-NBP2-34143-img0009.jpg "Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining of human gallbladder shows high expression.")
![Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/TFIIB-Antibody-Immunohistochemistry-Paraffin-NBP2-34143-img0010.jpg "Immunohistochemistry-Paraffin: TFIIB Antibody [NBP2-34143] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")