![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in human placenta and lymph node tissues. Corresponding WWTR1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunohistochemistry-Paraffin-NBP2-52926-img0015.jpg "Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in human placenta and lymph node tissues. Corresponding WWTR1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0371 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST |
| Epitope | SSWRKKILPESFFKE |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | WWTR1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WWTR1 |
![Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-WWTR1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Western-Blot-NBP2-52926-img0009.jpg "Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-WWTR1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in SKMEL cell line with Anti-WWTR1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are visualized in red (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunocytochemistry-Immunofluorescence-NBP2-52926-img0001.jpg "Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in SKMEL cell line with Anti-WWTR1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are visualized in red (where available). Antibody staining is shown in green.")
![Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Western-Blot-NBP2-52926-img0008.jpg "Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG")
![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human breast cancer shows moderate to strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunohistochemistry-Paraffin-NBP2-52926-img0011.jpg "Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human breast cancer shows moderate to strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human placenta shows strong nuclear and some cytoplasmic positivity in endothelial cells.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunohistochemistry-Paraffin-NBP2-52926-img0012.jpg "Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human placenta shows strong nuclear and some cytoplasmic positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules and in glomeruli.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunohistochemistry-Paraffin-NBP2-52926-img0013.jpg "Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules and in glomeruli.")
![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human lymph node shows no nuclear positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/TAZ-WWTR1-Antibody-CL0371-Immunohistochemistry-Paraffin-NBP2-52926-img0014.jpg "Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human lymph node shows no nuclear positivity in lymphoid cells as expected.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9968.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9969.jpg)
![Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af660_human-ctgf-ccn2-c-terminus-affinity-purified-polyclonal-ab-822024951141.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")