Home » Syntaxin-BP3/Munc18c » Syntaxin-BP3 Peptides and Proteins » Syntaxin-BP3/Munc18c Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Syntaxin-BP3/Munc18c Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Syntaxin-BP3/Munc18c Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STXBP3.

Source: E. coli

Amino Acid Sequence: FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STXBP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80636.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Syntaxin-BP3/Munc18c Recombinant Protein Antigen

  • MUNC18-3
  • Munc18c
  • Platelet Sec1 protein
  • Protein unc-18 homolog 3
  • Protein unc-18 homolog C
  • PSP
  • STXBP3
  • syntaxin 4 binding protein
  • syntaxin binding protein 3
  • syntaxin-binding protein 3
  • SyntaxinBP3
  • Syntaxin-BP3
  • unc18-3
  • Unc-18C

Background

Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
PSP/BPIFA2
Antibody (1F12) - BSA
NBP2-37493
ELISA PSP/BPIFA2 Antibody (1F12) - BSA Free
Western Blot PSP/BPIFA2 Antibody (1F12) - BSA Free
Immunocytochemistry/ Immunofluorescence PSP/BPIFA2 Antibody (1F12) - BSA Free
(1 Publication)
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Syntaxin 4 Antibody
NBP1-87374
Immunocytochemistry/ Immunofluorescence Syntaxin 4 Antibody
Western Blot Syntaxin 4 Antibody
Immunohistochemistry-Paraffin Syntaxin 4 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
SNAP23 Antibody
NBP2-20434
Western Blot SNAP23 Antibody
Immunocytochemistry/ Immunofluorescence SNAP23 Antibody
Western Blot SNAP23 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry VAMP-2 Antibody
Western Blot VAMP-2 Antibody
Western Blot VAMP-2 Antibody
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunocytochemistry/ Immunofluorescence alpha-Synuclein Antibody
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
ST8
alpha-2,8-Sialyltrans ...
AF6590
Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
HRSP12 Antibody
NBP1-82452
Western Blot HRSP12 Antibody
Western Blot HRSP12 Antibody
Immunohistochemistry-Paraffin HRSP12 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP) (0)

There are no publications for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP) (0)

There are no reviews for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syntaxin-BP3/Munc18c Products

Research Areas for Syntaxin-BP3/Munc18c Protein (NBP1-80636PEP)

Find related products by research area.

Blogs on Syntaxin-BP3/Munc18c

There are no specific blogs for Syntaxin-BP3/Munc18c, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Glut4 Antibody - BSA Free
NBP1-49533

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Syntaxin-BP3/Munc18c Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol STXBP3