Home » Syndecan-4 » Syndecan-4 Proteins » Syndecan-4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Syndecan-4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Syndecan-4 Protein (NBP1-90173PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Syndecan-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SDC4.

Source: E. coli

Amino Acid Sequence: PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SDC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90173.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Syndecan-4 Recombinant Protein Antigen

  • Amphiglycan
  • MGC22217
  • Ryudocan core protein
  • Ryudocan
  • SDC4
  • SYND4ryudocan amphiglycan
  • syndecan 4 (amphiglycan, ryudocan)
  • syndecan 4
  • syndecan proteoglycan 4
  • Syndecan4
  • Syndecan-4

Background

Syndecans are type I integral membrane proteoglycans that are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 is an matrix receptor which binds to Collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 interact with MK (midkine), a growth/differentiation factor involved in embryogenesis. Syndecan-2 is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan-4 functions cooperatively with integrins in the processes of cell spreading and focal adhesion assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Syndecan-1/CD138
Antibody
AF2780
Immunohistochemistry Syndecan-1/CD138 Antibody
Immunohistochemistry Syndecan-1/CD138 Antibody
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Syndecan-2/CD362
Antibody [Unconjugate ...
AF6585
Western Blot Syndecan-2/CD362 Antibody [Unconjugated]
Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]
Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(559 Publications)
Species: Hu
Applications: BA
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Glypican 1 Antibody
NBP1-33197
Western Blot Glypican 1 Antibody
Western Blot Glypican 1 Antibody
Western Blot Glypican 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB

Endorepellin/Perlecan/ ...
AF2364
Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
NIK/MAP3K14
Antibody - BSA Free
NBP2-23603
Immunocytochemistry/ Immunofluorescence NIK/MAP3K14 Antibody - BSA Free
Immunohistochemistry NIK/MAP3K14 Antibody - BSA Free
Western Blot NIK/MAP3K14 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
SDC3 Antibody
[Unconjugated]
AF3539
Immunocytochemistry SDC3 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
FGF-13 Antibody
NBP2-16471
Immunohistochemistry-Paraffin FGF-13 Antibody
Western Blot FGF-13 Antibody
Immunohistochemistry-Paraffin FGF-13 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Decorin Antibody
[Unconjugated]
AF1060
Simple Western Decorin Antibody [Unconjugated]
Western Blot Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FAK Antibody
(495919) [Unconjugate
MAB4467
Immunohistochemistry FAK Antibody (495919) [Unconjugated]
Western Blot FAK Antibody (495919) [Unconjugated]
Knockout Validated FAK Antibody (495919) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
Transglutaminase
2/TGM2 Antibody [Unco ...
AF4376
Western Blot Transglutaminase 2/TGM2 Antibody [Unconjugated]
Simple Western Transglutaminase 2/TGM2 Antibody [Unconjugated]
Knockout Validated Transglutaminase 2/TGM2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IP, KO, Simple Western, WB

Publications for Syndecan-4 Protein (NBP1-90173PEP) (0)

There are no publications for Syndecan-4 Protein (NBP1-90173PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syndecan-4 Protein (NBP1-90173PEP) (0)

There are no reviews for Syndecan-4 Protein (NBP1-90173PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Syndecan-4 Protein (NBP1-90173PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syndecan-4 Products

Research Areas for Syndecan-4 Protein (NBP1-90173PEP)

Find related products by research area.

Blogs on Syndecan-4

There are no specific blogs for Syndecan-4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Syndecan-4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SDC4