![Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Analysis in human lung and liver tissues using NBP1-88589 antibody. Corresponding SUSD2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUSD2-Antibody-Immunohistochemistry-Paraffin-NBP1-88589-img0006.jpg "Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Analysis in human lung and liver tissues using NBP1-88589 antibody. Corresponding SUSD2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUSD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SUSD2 Antibody (NBP1-88589)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUSD2 |
![Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human lung shows high expression.](http://images.novusbio.com/fullsize/SUSD2-Antibody-Immunohistochemistry-Paraffin-NBP1-88589-img0003.jpg "Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human lung shows high expression.")
![Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/SUSD2-Antibody-Immunohistochemistry-Paraffin-NBP1-88589-img0004.jpg "Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human liver shows low positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-88589_rabbit-polyclonal-susd2-antibody-immunohistochemistry-paraffin-1642024123134..jpg "Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human liver shows low positivity in hepatocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot CEACAM1/CD66a Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-1_AF6480_Western_Blot_10239.jpg)
![Flow Cytometry CEACAM1/CD66a Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-1_AF6480_Flow_Cytometry_11937.jpg)
![Immunohistochemistry CEACAM1/CD66a Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-1_AF6480_Immunohistochemistry_11978.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")