![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0017.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF reported in scientific literature (PMID: 26356418). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87395 | Applications | Species |
|---|---|---|
| Chaumet A, Wright GD, Seet SH et al. Nuclear envelope-associated endosomes deliver surface proteins to the nucleus. Nat Commun 2015-09-10 [PMID: 26356418] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUN1 Antibody (NBP1-87395)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUN1 |
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87395 (A) shows similar protein distribution across tissues to independent antibody NBP1-87396 (B).](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0019.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87395 (A) shows similar protein distribution across tissues to independent antibody NBP1-87396 (B).")
![Western Blot: SUN1 Antibody [NBP1-87395] - Analysis using Anti-SUN1 antibody NBP1-87395 (A) shows similar pattern to independent antibody NBP1-87396 (B).](http://images.novusbio.com/fullsize/SUN1-Antibody-Western-Blot-NBP1-87395-img0012.jpg "Western Blot: SUN1 Antibody [NBP1-87395] - Analysis using Anti-SUN1 antibody NBP1-87395 (A) shows similar pattern to independent antibody NBP1-87396 (B).")
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87395] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & vesicles.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87395-img0010.jpg "Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87395] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & vesicles.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0023.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0018.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0020.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0021.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87395-img0022.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")