![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding SGSH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0014.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding SGSH RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL |
| Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SGSH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SGSH |
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human adrenal gland, duodenum, kidney and skeletal muscle using Anti-SGSH antibody (A) NBP1-83165 shows similar protein distribution across tissues to independent antibody NBP1-83164 (B).](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0020.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human adrenal gland, duodenum, kidney and skeletal muscle using Anti-SGSH antibody (A) NBP1-83165 shows similar protein distribution across tissues to independent antibody NBP1-83164 (B).")
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human adrenal gland shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0015.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human adrenal gland shows strong cytoplasmic granular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human duodenum shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0016.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human duodenum shows strong cytoplasmic granular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0017.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0018.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Sulfamidase-SGSH-Antibody-Immunohistochemistry-Paraffin-NBP1-83165-img0019.jpg "Immunohistochemistry-Paraffin: Sulfamidase/SGSH Antibody [NBP1-83165] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")