Home » SRGN » SRGN Proteins » SRGN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SRGN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SRGN Protein (NBP1-80886PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SRGN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRGN.

Source: E. coli

Amino Acid Sequence: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SRGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80886.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SRGN Recombinant Protein Antigen

  • FLJ12930
  • Hematopoetic proteoglycan core protein
  • MGC9289
  • P.PG
  • Platelet proteoglycan core protein
  • platelet proteoglycan protein core
  • PPG
  • PRG1p.PG
  • PRGhematopoetic proteoglycan core peptide
  • proteoglycan 1, secretory granule
  • proteoglycan protein core for mast cell secretory granule
  • secretory granule proteoglycan 1
  • secretory granule proteoglycan core peptide
  • Secretory granule proteoglycan core protein
  • serglycin proteoglycan
  • Serglycin
  • SRGN

Background

SRGN encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
IER3 Antibody -
BSA Free
NBP1-76802
Immunohistochemistry IER3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence IER3 Antibody - BSA Free
Western Blot IER3 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cystathionase
Antibody (4E1-1B7)
H00001491-M01
Western Blot Cystathionase Antibody (4E1-1B7)
Western Blot Cystathionase Antibody (4E1-1B7)
Immunohistochemistry-Paraffin Cystathionase Antibody (4E1-1B7)
(32 Publications)
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin ASAH1 Antibody
Immunohistochemistry-Paraffin ASAH1 Antibody
Immunohistochemistry-Paraffin ASAH1 Antibody
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Vitamin D BP
Antibody
NBP1-88027
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
(2 Reviews)
(1 Publication)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunohistochemistry HSD17B4 Antibody (OTI4C4)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
ARHGEF11 Antibody
NBP1-83314
Western Blot ARHGEF11 Antibody
Immunohistochemistry-Paraffin ARHGEF11 Antibody
Immunohistochemistry-Paraffin ARHGEF11 Antibody
(2 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
SRGN Recombinant
Protein Antigen
NBP1-80886PEP
SRGN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SRGN Protein (NBP1-80886PEP) (0)

There are no publications for SRGN Protein (NBP1-80886PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGN Protein (NBP1-80886PEP) (0)

There are no reviews for SRGN Protein (NBP1-80886PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SRGN Protein (NBP1-80886PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRGN Products

Research Areas for SRGN Protein (NBP1-80886PEP)

Find related products by research area.

Blogs on SRGN

There are no specific blogs for SRGN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SRGN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SRGN