![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0008.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS |
| Predicted Species | Mouse (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRGAP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-88831 | Applications | Species |
|---|---|---|
| Chen Z, Zhang S, Nie B et al. Distinct roles of srGAP3-Rac1 in the initiation and maintenance phases of neuropathic pain induced by paclitaxel J. Physiol. (Lond.) 2020-04-01 [PMID: 32237255] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRGAP3 |
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-SRGAP3 antibody NBP1-88831 (A) shows similar protein distribution across tissues to independent antibody NBP2-38521 (B).](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0009.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-SRGAP3 antibody NBP1-88831 (A) shows similar protein distribution across tissues to independent antibody NBP2-38521 (B).")
![Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Western-Blot-NBP1-88831-img0004.jpg "Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex")
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human lymph node.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0012.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0006.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0007.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human testis.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0010.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human testis.")
![Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human urinary bladder.](http://images.novusbio.com/fullsize/SRGAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-88831-img0011.jpg "Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human urinary bladder.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")