![Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/ARHGAP1-Antibody-Western-Blot-NBP1-85724-img0018.jpg "Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ARHGAP1 Antibody (NBP1-85724)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ARHGAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85724-img0017.jpg "Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.")
![Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize/ARHGAP1-Antibody-Western-Blot-NBP1-85724-img0015.jpg "Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in human cell line MCF-7.")
![Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ARHGAP1-Antibody-Western-Blot-NBP1-85724-img0016.jpg "Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse dentate gyrus shows immunoreactivity in polymorph layer.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-13520231531470.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse dentate gyrus shows immunoreactivity in polymorph layer.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse dentate gyrus shows immunoreactivity in polymorph layer.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-175202313342023.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse dentate gyrus shows immunoreactivity in polymorph layer.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-1752023133404.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-175202313342048.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-17520231332150.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons.")
![Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse brain shows neuronal staining in lateral paragigantocellular nucleus.](http://images.novusbio.com/fullsize/nbp1-85724_rabbit-polyclonal-arhgap1-antibody-175202313342047.jpg "Immunohistochemistry: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse brain shows neuronal staining in lateral paragigantocellular nucleus.")
![PIN/DLC8 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PIN/DLC8 Antibody [Unconjugated]")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")