![Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in human cell line EFO-21.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Western-Blot-NBP1-88247-img0018.jpg "Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in human cell line EFO-21.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERLIN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SPFH2 Antibody (NBP1-88247)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERLIN2 |
![Immunocytochemistry/Immunofluorescence: SPFH2 Antibody [NBP1-88247] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88247-img0010.jpg "Immunocytochemistry/Immunofluorescence: SPFH2 Antibody [NBP1-88247] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88247-img0017.jpg "Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Western-Blot-NBP1-88247-img0009.jpg "Western Blot: SPFH2 Antibody [NBP1-88247] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88247-img0014.jpg "Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88247-img0015.jpg "Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SPFH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88247-img0016.jpg "Immunohistochemistry-Paraffin: SPFH2 Antibody [NBP1-88247] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![Immunohistochemistry Gremlin 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Gremlin_AF956_Immunohistochemistry_6919.jpg)
![Immunohistochemistry Gremlin 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Gremlin_AF956_Immunohistochemistry_23514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")