Soluble Liver/Pancreas Antigen Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Soluble Liver/Pancreas Antigen. Source: E. coli Amino Acid Sequence: EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
SEPSECS |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57464. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen
Background
The 21st amino acid, selenocysteine (sec), is distinct from other amino acids because it lacks its own tRNA synthetase and is the only amino acid synthesized on its cognate tRNA. Synthesis of sec begins with acylation of tRNA(sec) (TRSP; MIM 165060) by seryl-tRNA synthetase (SARS; MIM 607529) to give ser-tRNA(sec), which is subsequently phosphorylated by O-phosphoseryl-tRNA kinase (PSTK; MIM 611310) to give O-phosphoseryl-tRNA(sec). SEPSECS catalyzes the final step of sec synthesis by converting O-phosphoseryl-tRNA(sec) to selenocysteinyl-tRNA(sec) using selenophosphate as the selenium donor (Palioura et al., 2009 (PubMed 19608919)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)
There are no publications for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)
There are no reviews for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP) (0)
Additional Soluble Liver/Pancreas Antigen Products
Research Areas for Soluble Liver/Pancreas Antigen Recombinant Protein Antigen (NBP2-57464PEP)
Find related products by research area.
|
Blogs on Soluble Liver/Pancreas Antigen