![Western Blot: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Western blot analysis of extracts of various cell lines, using SMARCC1 Rabbit mAb (NBP3-16367) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/SMARCC1-Antibody-1R7I6-Western-Blot-NBP3-16367-img0002.jpg "Western Blot: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Western blot analysis of extracts of various cell lines, using SMARCC1 Rabbit mAb (NBP3-16367) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IP, ChIP |
| Clone | 1R7I6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1 (Q92922). AFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SMARCC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SMARCC1 Antibody (NBP3-16367)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMARCC1 |
![Immunocytochemistry/Immunofluorescence: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Immunofluorescence analysis of NIH-3T3 cells using SMARCC1 Rabbit mAb (NBP3-16367) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SMARCC1-Antibody-1R7I6-Immunocytochemistry-Immunofluorescence-NBP3-16367-img0001.jpg "Immunocytochemistry/Immunofluorescence: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Immunofluorescence analysis of NIH-3T3 cells using SMARCC1 Rabbit mAb (NBP3-16367) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Chromatin immunoprecipitation analysis of extracts of MCF7 beta-estradiol cells, using SMARCC1 antibody (NBP3-16367) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/SMARCC1-Antibody-1R7I6-Chromatin-Immunoprecipitation-NBP3-16367-img0004.jpg "Chromatin Immunoprecipitation: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Chromatin immunoprecipitation analysis of extracts of MCF7 beta-estradiol cells, using SMARCC1 antibody (NBP3-16367) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Immunoprecipitation: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug SMARCC1 antibody (NBP3-16367). Western blot was performed from the immunoprecipitate using SMARCC1 antibody (NBP3-16367) at a dilition of 1:500.](http://images.novusbio.com/fullsize/SMARCC1-Antibody-1R7I6-Immunoprecipitation-NBP3-16367-img0003.jpg "Immunoprecipitation: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug SMARCC1 antibody (NBP3-16367). Western blot was performed from the immunoprecipitate using SMARCC1 antibody (NBP3-16367) at a dilition of 1:500.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")