Novus Biologicals products are now on bio-techne.com

Smad5 Recombinant Protein Antigen

Images

 
There are currently no images for Smad5 Protein (NBP2-32406PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Smad5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMAD5.

Source: E. coli

Amino Acid Sequence: PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMAD5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32406.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Smad5 Recombinant Protein Antigen

  • Dwfc
  • hSmad5
  • JV5-1
  • JV5-1DKFZp781O1323
  • MAD homolog 5
  • MAD, mothers against decapentaplegic homolog 5 (Drosophila)
  • MADH5
  • MADH5mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic, drosophila, homolog of, 5
  • Mothers against DPP homolog 5
  • SMA- and MAD-related protein 5
  • SMAD 5
  • SMAD family member 5DKFZp781C1895
  • SMAD, mothers against DPP homolog 5 (Drosophila)
  • SMAD, mothers against DPP homolog 5
  • Smad5

Background

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35329
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
314-BP
Species: Hu
Applications: BA, BA
AF7215
Species: Hu, Mu
Applications: ICC, IHC
AF2097
Species: Hu
Applications: ChIP, ICC, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
354-BP
Species: Hu
Applications: BA
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56440
Species: Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
AF370
Species: Hu
Applications: IP, WB
7754-BH/CF
Species: Hu
Applications: BA
507-BP
Species: Hu
Applications: BA
DPI00
Species: Hu
Applications: ELISA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for Smad5 Protein (NBP2-32406PEP) (0)

There are no publications for Smad5 Protein (NBP2-32406PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad5 Protein (NBP2-32406PEP) (0)

There are no reviews for Smad5 Protein (NBP2-32406PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Smad5 Protein (NBP2-32406PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smad5 Products

Research Areas for Smad5 Protein (NBP2-32406PEP)

Find related products by research area.

Blogs on Smad5

There are no specific blogs for Smad5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Smad5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD5