![Immunocytochemistry/Immunofluorescence: SLC34A1 Antibody [NBP2-13328] - Staining of human cell line HEL shows localization to nuclear speckles, plasma membrane & mitotic spindle. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13328-img0006.jpg "Immunocytochemistry/Immunofluorescence: SLC34A1 Antibody [NBP2-13328] - Staining of human cell line HEL shows localization to nuclear speckles, plasma membrane & mitotic spindle. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC34A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC34A1 Antibody (NBP2-13328)Find related products by research area.
|
|
SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC34A1 |
![Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human stomach shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13328-img0011.jpg "Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human stomach shows no positivity in glandular cells as expected.")
![Immunohistochemistry: SLC34A1 Antibody [NBP2-13328] - Immunohistochemical analysis of the apical (closed arrows) and intracellular (open arrows) NaPi-2a (SLC34A1) expression in the kidney. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116590) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunohistochemistry-NBP2-13328-img0007.jpg "Immunohistochemistry: SLC34A1 Antibody [NBP2-13328] - Immunohistochemical analysis of the apical (closed arrows) and intracellular (open arrows) NaPi-2a (SLC34A1) expression in the kidney. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0116590) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human kidney shows moderate cytoplasmic and luminal membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13328-img0008.jpg "Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human kidney shows moderate cytoplasmic and luminal membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13328-img0009.jpg "Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13328-img0010.jpg "Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images2/FGF23_MAB26291_Immunohistochemistry_17626.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412512640.jpg)
![Western Blot FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412514876.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Immunohistochemistry Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Immunohistochemistry_6720.jpg)
![Western Blot Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Western_Blot_22658.jpg)
![ELISA Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_ELISA_22841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")