![Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Analysis in human lung and skeletal muscle tissues using NBP1-81013 antibody. Corresponding SLC34A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC34A2-Antibody-Immunohistochemistry-Paraffin-NBP1-81013-img0009.jpg "Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Analysis in human lung and skeletal muscle tissues using NBP1-81013 antibody. Corresponding SLC34A2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC34A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Corey . |
IF | Other | 09/20/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC34A2 Antibody (NBP1-81013)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human fallopian tube shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC34A2-Antibody-Immunohistochemistry-Paraffin-NBP1-81013-img0011.jpg "Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human fallopian tube shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human lung shows high expression.](http://images.novusbio.com/fullsize/SLC34A2-Antibody-Immunohistochemistry-Paraffin-NBP1-81013-img0007.jpg "Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human lung shows high expression.")
![Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC34A2-Antibody-Immunohistochemistry-Paraffin-NBP1-81013-img0010.jpg "Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC34A2-Antibody-Immunohistochemistry-Paraffin-NBP1-81013-img0012.jpg "Immunohistochemistry-Paraffin: SLC34A2 Antibody [NBP1-81013] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images2/FGF23_MAB26291_Immunohistochemistry_17626.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412512640.jpg)
![Western Blot FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412514876.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
