Home » SLC26A3 » SLC26A3 Proteins » SLC26A3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC26A3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC26A3 Protein (NBP1-84450PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

SLC26A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC26A3.

Source: E. coli

Amino Acid Sequence: DQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC26A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84450.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC26A3 Recombinant Protein Antigen

  • chloride anion exchanger
  • CLD
  • congenital chloride diarrhea
  • down-regulated in adenoma protein
  • DRADown-regulated in adenoma
  • Protein DRA
  • Solute carrier family 26 member 3
  • solute carrier family 26, member 3

Background

SLC26A3 is encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
SLC26A6 Antibody
NBP2-47273
Western Blot SLC26A6 Antibody
Immunohistochemistry-Paraffin SLC26A6 Antibody
Immunohistochemistry-Paraffin SLC26A6 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLC26A4 Antibody
NBP1-85237
Immunohistochemistry-Paraffin SLC26A4 Antibody
Immunohistochemistry-Frozen SLC26A4 Antibody
Immunohistochemistry-Paraffin SLC26A4 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
SLC26A2 Antibody
NBP2-49271
Western Blot SLC26A2 Antibody
Immunohistochemistry-Paraffin SLC26A2 Antibody
Immunohistochemistry-Paraffin SLC26A2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NHE3/SLC9A3
Antibody
NBP1-82574
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
(31 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(37 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
HLA-DR Antibody
(L243) - BSA Free
NB100-77855
Flow (Cell Surface) HLA-DR Antibody (L243) - BSA Free
Flow Cytometry HLA-DR Antibody (L243) - BSA Free
Flow Cytometry HLA-DR Antibody (L243) - BSA Free
(1 Review)
(38 Publications)
Species: Pm, Ca, Hu, Pm
Applications: B/N, CyTOF-ready, Dual ISH-IHC, EM, ELISA, Flow-CS, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(458 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
SLC26A1 Antibody
NBP1-84897
Immunohistochemistry-Paraffin SLC26A1 Antibody
Immunocytochemistry/ Immunofluorescence SLC26A1 Antibody
(2 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
SLC26A5 Antibody
NBP1-59791
Immunohistochemistry-Paraffin SLC26A5 Antibody
Western Blot SLC26A5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
SLC36A1 Antibody
NBP2-80524
SLC36A1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LIPC Antibody -
BSA Free
NBP3-04922
Immunocytochemistry/ Immunofluorescence LIPC Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
APPBP2 Antibody -
BSA Free
NBP2-81781
Western Blot APPBP2 Antibody - BSA Free
Immunohistochemistry APPBP2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence APPBP2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SLC26A3
Recombinant Protein A
NBP1-84450PEP
SLC26A3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SLC26A3 Protein (NBP1-84450PEP) (0)

There are no publications for SLC26A3 Protein (NBP1-84450PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A3 Protein (NBP1-84450PEP) (0)

There are no reviews for SLC26A3 Protein (NBP1-84450PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC26A3 Protein (NBP1-84450PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC26A3 Products

Research Areas for SLC26A3 Protein (NBP1-84450PEP)

Find related products by research area.

Blogs on SLC26A3.

Check out the latest blog posts on SLC26A3.
Next-Gen DNA Sequencing and SLC26A3 Research
The SLC26A3, also known as DRA (downregulated-in-adenoma) gene is a member of the sulphate anion transporter family, serving an important role in the exchange and transport of chloride, bicarbonate and sulphate ions at plasma membrane sites. We at Nov...  Read full blog post.
Antibody Therapies and the New Generation of DNA Sequencing
Our antibody database is primarily focused on protein-coding genes. Although they form only 1% of the total human genome, these important genes account for 85% of the mutations that lead to disease.DNA sequencing (defining the sequence of the 4 base...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC26A3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC26A3