![Immunohistochemistry: SLC14A1 Antibody [NBP2-31781] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-31781_rabbit-polyclonal-slc14a1-antibody-immunohistochemistry-paraffin-22220241019..jpg "Immunohistochemistry: SLC14A1 Antibody [NBP2-31781] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC14A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Kell Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kell Antibody [Unconjugated]")
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human urinary bladder shows strong cytoplasmic positivity in erythrocytes.](http://images.novusbio.com/fullsize/antibody/nbp2-31781_rabbit-polyclonal-slc14a1-antibody-immunohistochemistry-paraffin-222202410217..jpg "Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human urinary bladder shows strong cytoplasmic positivity in erythrocytes.")
![Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human prostate shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-31781_rabbit-polyclonal-slc14a1-antibody-immunohistochemistry-paraffin-222202410324..jpg "Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human prostate shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human placenta shows moderate cytoplasmic positivity in endothelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-31781_rabbit-polyclonal-slc14a1-antibody-immunohistochemistry-paraffin-222202410427..jpg "Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human placenta shows moderate cytoplasmic positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-31781_rabbit-polyclonal-slc14a1-antibody-immunohistochemistry-paraffin-222202410531..jpg "Immunohistochemistry-Paraffin: SLC14A1 Antibody [NBP2-31781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Immunohistochemistry_15918.jpg)
![Western Blot DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Western_Blot_10725.jpg)
![Flow Cytometry DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Flow_Cytometry_18905.jpg)
![Immunocytochemistry RGM-C/Hemojuvelin Antibody [Unconjugated]](https://images.novusbio.com/images2/RGM-C_AF3720_Immunocytochemistry_12460.jpg)
![Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Immunohistochemistry_19187.jpg)
![Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Flow_Cytometry_19288.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")