Home » SF3B4 » SF3B4 Proteins » SF3B4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SF3B4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SF3B4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3B4.

Source: E. coli

Amino Acid Sequence: VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3B4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55882.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF3B4 Recombinant Protein Antigen

  • Hsh49
  • pre-mRNA splicing factor SF3b 49 kDa subunit
  • Pre-mRNA-splicing factor SF3b 49 kDa subunit
  • SAP 49
  • SAP49MGC10828
  • SF3b49
  • SF3b50
  • spliceosomal protein
  • spliceosome-associated protein (U2 snRNP)
  • Spliceosome-associated protein 49
  • splicing factor 3B subunit 4
  • splicing factor 3b, subunit 4, 49kD
  • splicing factor 3b, subunit 4, 49kDa

Background

The SF3B4 gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SF3B2 Antibody
NB100-79848
Immunohistochemistry-Paraffin SF3B2 Antibody
Western Blot SF3B2 Antibody
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
SAP155 Antibody
(6C7)
NBP3-26326
Immunohistochemistry SAP155 Antibody (6C7)
Immunohistochemistry SAP155 Antibody (6C7)
Western Blot SAP155 Antibody (6C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
U1A Antibody
NBP2-53095
Western Blot U1A Antibody
Immunocytochemistry/ Immunofluorescence U1A Antibody
Immunohistochemistry-Paraffin U1A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DHX16 Antibody
NBP2-13920
Immunocytochemistry/ Immunofluorescence DHX16 Antibody
Immunohistochemistry-Paraffin DHX16 Antibody
Immunohistochemistry-Paraffin DHX16 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SF3B14 Antibody
NBP1-87431
Immunocytochemistry/ Immunofluorescence SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PRPF8 Antibody -
BSA Free
NBP2-93689
Immunocytochemistry/ Immunofluorescence PRPF8 Antibody - BSA Free
Western Blot PRPF8 Antibody - BSA Free
Immunohistochemistry-Paraffin PRPF8 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SNRP70 Antibody
NBP1-57487
Immunohistochemistry-Paraffin SNRP70 Antibody
Western Blot SNRP70 Antibody
Western Blot SNRP70 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SAP130 Antibody
NB100-1077
Western Blot SAP130 Antibody
(1 Review)
(3 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-Fr, PEP-ELISA, WB
CDK2AP2 Antibody
H00010263-B01P
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Western Blot CDK2AP2 Antibody
Species: Hu, Mu, Rt
Applications: WB
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/ Immunofluorescence ROBLD3 Antibody
Immunohistochemistry ROBLD3 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
CUGBP2 Antibody
(PCRP-CELF2-1E4)
NBP3-13841
Flow Cytometry CUGBP2 Antibody (PCRP-CELF2-1E4)
Flow Cytometry CUGBP2 Antibody (PCRP-CELF2-1E4)
Flow Cytometry CUGBP2 Antibody (PCRP-CELF2-1E4)
Species: Hu
Applications: Flow, ICC/IF, PA
RPP14 Antibody
NBP1-80965
Western Blot RPP14 Antibody
Immunocytochemistry/ Immunofluorescence RPP14 Antibody
Immunohistochemistry-Paraffin RPP14 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TXNL4A Antibody
(1C4)
H00010907-M01
Western Blot TXNL4A Antibody (1C4)
Sandwich ELISA TXNL4A Antibody (1C4)
Species: Hu
Applications: ELISA, S-ELISA, WB
WBP4 Antibody
NBP1-84718
Western Blot WBP4 Antibody
Immunohistochemistry-Paraffin WBP4 Antibody
Immunohistochemistry-Paraffin WBP4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SMN Antibody (2B1)
NB100-1936
Immunohistochemistry SMN Antibody (2B1)
Western Blot SMN Antibody (2B1)
Immunohistochemistry SMN Antibody (2B1)
(24 Publications)
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
SMN2 Antibody
(2B11-2A9)
H00006607-M01
Immunocytochemistry/ Immunofluorescence SMN2 Antibody (2B11-2A9)
Immunohistochemistry-Paraffin SMN2 Antibody (2B11-2A9)
ELISA SMN2 Antibody (2B11-2A9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SF3B4 Recombinant
Protein Antigen
NBP2-55882PEP
SF3B4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no publications for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no reviews for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF3B4 Products

Array NBP2-55882PEP

Research Areas for SF3B4 Recombinant Protein Antigen (NBP2-55882PEP)

Find related products by research area.

Blogs on SF3B4

There are no specific blogs for SF3B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counte-rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
S100A9 Antibody [Unconjugated]
AF2065

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF3B4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SF3B4