Home » SF-1/NR5A1/Steroidogenic Factor 1 » SF-1/NR5A1/Steroidogenic Factor 1 Proteins » SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF-1/NR5A1/Steroidogenic Factor 1

Source: E.coli

Amino Acid Sequence: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR5A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21418. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen

  • AD4BP
  • AD4BPSTF-1
  • Adrenal 4-binding protein
  • ELP
  • FTZ1adrenal 4 binding protein
  • FTZF1
  • FTZF1nuclear receptor AdBP4
  • Fushi tarazu factor homolog 1
  • NR5A1
  • Nuclear receptor subfamily 5 group A member 1
  • nuclear receptor subfamily 5, group A, member 1
  • SF1
  • SF-1
  • SF-1POF7
  • SF1steroidogenic factor 1
  • Steroid hormone receptor Ad4BP
  • steroidogenic factor-1

Background

Steroidogenic factor 1 (SF-1), a NR5 Fushi Tarazu-Like Receptor, has been shown to affect sexual differentiation, steroid metabolism, and neural development. SF-1 binds as a monomer and regulates all steroidogenic p450 genes, Mullerian inhibiting substance, the gonadotrophins, the ACTH receptor, oxytocin, nuclear receptor DAX-1, and several other genes. Four alternatively spliced isoforms of SF-1 have been isolated in mice, and they differ at the N and C termini but are identical in the DNA-binding domain. SF-1 expression has been documented in human brain, adrenal, spleen, liver, heart, ovary, testis, and placenta. ESTs have been isolated from human tissue libraries, including cancerous adrenal and normal lung and testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB
LRH-1/NR5A2
Antibody
NBP2-27196
Immunohistochemistry-Paraffin LRH-1/NR5A2 Antibody
Western Blot LRH-1/NR5A2 Antibody
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Aromatase Antibody
NB100-1596
Western Blot Aromatase Antibody
Western Blot Aromatase Antibody
Immunohistochemistry-Paraffin Aromatase Antibody
(16 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
StAR Antibody
NBP1-33485
Western Blot StAR Antibody
Western Blot StAR Antibody
Immunohistochemistry-Paraffin StAR Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CYP11A1 Antibody
NBP1-85368
Immunohistochemistry-Paraffin CYP11A1 Antibody
Immunohistochemistry-Paraffin CYP11A1 Antibody
Immunohistochemistry-Paraffin CYP11A1 Antibody
(4 Reviews)
(3 Publications)
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Flow Cytometry Cytochrome P450 17A1 Antibody (OTI3F11)
(2 Reviews)
(6 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(154 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGR1 Antibody
[Unconjugated]
AF2818
Immunocytochemistry EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
CYP11B2 Antibody
NBP2-13891
Immunohistochemistry-Paraffin CYP11B2 Antibody
Immunohistochemistry-Paraffin CYP11B2 Antibody
Immunohistochemistry-Paraffin CYP11B2 Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
WT1 Antibody
(6F-H2) - BSA Free
NB110-60011
Western Blot WT1 Antibody (6F-H2) - BSA Free
Immunohistochemistry-Paraffin WT1 Antibody (6F-H2) - BSA Free
Western Blot WT1 Antibody (6F-H2) - BSA Free
(3 Reviews)
(16 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
P2X5/P2RX5 Antibody
NBP2-19658
Immunohistochemistry-Paraffin P2X5/P2RX5 Antibody
Immunocytochemistry/ Immunofluorescence P2X5/P2RX5 Antibody
Western Blot P2X5/P2RX5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
CYP11B1 Antibody
NBP1-68883
Western Blot CYP11B1 Antibody
Immunohistochemistry CYP11B1 Antibody
Immunohistochemistry CYP11B1 Antibody
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
COUP-TF I/NR2F1
Antibody (H8132) [Unc ...
PP-H8132-00
COUP-TF I/NR2F1 Antibody (H8132) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

SF-1/NR5A1/Steroidogen ...
NBP3-21418PEP
SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF-1/NR5A1/Steroidogenic Factor 1 Products

Research Areas for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP)

Find related products by research area.

Blogs on SF-1/NR5A1/Steroidogenic Factor 1

There are no specific blogs for SF-1/NR5A1/Steroidogenic Factor 1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
SOX9 Antibody [Unconjugated]
AF3075
Western Blot: WT1 Antibody (6F-H2) [NB110-60011] - Whole cell protein from human K562, HEK293 and kidney tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-WT1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
WT1 Antibody (6F-H2) - BSA Free
NB110-60011

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NR5A1