Novus Biologicals products are now on bio-techne.com

Serotonin N-acetyltransferase Recombinant Protein Antigen

Images

 
There are currently no images for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Serotonin N-acetyltransferase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serotonin N-acetyltransferase.

Source: E. coli

Amino Acid Sequence: FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AANAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55364.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serotonin N-acetyltransferase Recombinant Protein Antigen

  • AA-NAT
  • aralkylamine N-acetyltransferaseEC 2.3.1.87
  • arylalkylamine N-acetyltransferase
  • Serotonin acetylase
  • SNATserotonin N-acetyltransferase

Background

Arylalkylamine N-Acetyltransferase (AANAT) is the main enzyme for melatonin synthesis. Hormonal melatonin has been implicated in sleep and circadian clock function, and acts as"the hormone of the night." Large changes in the abundance of AANAT are believed to be responsible for the large day/night rhythms in melatonin synthesis in the pineal gland and retina. Most research shows that AANAT activity is regulated by controlling the steady-state levels of the protein. Recent research, however, suggests that another mechanism may also play a role in controlling melatonin production without altering AANAT protein and activity. This mechanism may explain the sudden physiological increase in circulating melatonin observed at the onset of the dark period in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43801
Species: Hu, Mu, Rt
Applications: WB
664-LI
Species: Hu
Applications: BA
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-2288
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NBP1-28912
Species: Rt
Applications: PEP-ELISA, WB
NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-86922
Species: Hu
Applications: IHC, IHC-P, WB
DY4517-05
Species: Mu
Applications: ELISA
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NLS932
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP) (0)

There are no publications for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP) (0)

There are no reviews for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serotonin N-acetyltransferase Products

Research Areas for Serotonin N-acetyltransferase Recombinant Protein Antigen (NBP2-55364PEP)

Find related products by research area.

Blogs on Serotonin N-acetyltransferase

There are no specific blogs for Serotonin N-acetyltransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serotonin N-acetyltransferase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AANAT