![Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Staining of human cell line PC-3 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13290-img0005.jpg "Immunocytochemistry/Immunofluorescence: SEC61B Antibody [NBP2-13290] - Staining of human cell line PC-3 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEC61B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Simple Western Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Simple_Western_20944.jpg)
![Western Blot Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Western_Blot_5806.jpg)
![Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Immunohistochemistry_19570.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SEC61B Antibody (NBP2-13290)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEC61B |
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human cerebellum shows moderate to strong positivity in endoplasmic reticulum in Purkinje cells.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0009.jpg "Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human cerebellum shows moderate to strong positivity in endoplasmic reticulum in Purkinje cells.")
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows moderate to strong positivity in endoplasmic reticulum in exocrine glandular cells.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0006.jpg "Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human pancreas shows moderate to strong positivity in endoplasmic reticulum in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human liver shows moderate positivity in endoplasmic reticulum in hepatocytes.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0007.jpg "Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human liver shows moderate positivity in endoplasmic reticulum in hepatocytes.")
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human duodenum shows moderate to strong positivity in endoplasmic reticulum in glandular cells.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0008.jpg "Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human duodenum shows moderate to strong positivity in endoplasmic reticulum in glandular cells.")
![Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SEC61B-Antibody-Immunohistochemistry-Paraffin-NBP2-13290-img0010.jpg "Immunohistochemistry-Paraffin: SEC61B Antibody [NBP2-13290] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/IL-1ra_DRA00_ELISA_392.jpg)
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/DATA_IL1ra_DRA00_ELISA_802.jpg)
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/DATA_IL1ra_DRA00_ELISA_803.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")