Home » SEC6 » SEC6 Proteins » SEC6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SEC6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SEC6 Recombinant Protein Antigen (NBP2-55179PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SEC6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to SEC6.

Source: E. coli

Amino Acid Sequence: VENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EXOC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55179.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SEC6 Recombinant Protein Antigen

  • exocyst complex component 3
  • Exocyst complex component Sec6
  • Sec 6 homolog
  • SEC6
  • SEC6L1
  • SEC6-like 1 (S. cerevisiae)
  • SEC6-like 1
  • Sec6p

Background

SEC6 is encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sec8 Antibody
(14G1)
NBP1-97492
Immunohistochemistry-Paraffin Sec8 Antibody (14G1)
Western Blot Sec8 Antibody (14G1)
(3 Publications)
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
EXOC2 Antibody -
BSA Free
NBP3-04535
Western Blot EXOC2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence EXOC2 Antibody - BSA Free
Immunoprecipitation EXOC2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IP, WB
EXOC7 Antibody
NB100-94901
Immunohistochemistry-Paraffin EXOC7 Antibody
Western Blot EXOC7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
EXOC6 Antibody
NBP1-85031
Western Blot EXOC6 Antibody
Immunohistochemistry-Paraffin EXOC6 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RalA/RalB Antibody
AF3204
Western Blot RalA/RalB Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
EXOC5 Antibody
NBP2-99472
Immunohistochemistry-Paraffin EXOC5 Antibody
Immunohistochemistry-Paraffin EXOC5 Antibody
Immunohistochemistry-Paraffin EXOC5 Antibody
Species: Hu, Mu, Rt
Applications: IHC-P
SEC3 Antibody
NBP1-89957
Immunohistochemistry-Paraffin SEC3 Antibody
Western Blot SEC3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TC10 Antibody
(10F7Y7)
NBP3-15915
Immunohistochemistry-Paraffin TC10 Antibody (10F7Y7)
Western Blot TC10 Antibody (10F7Y7)
Western Blot TC10 Antibody (10F7Y7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
EXOC8 Antibody
NBP1-91444
Western Blot EXOC8 Antibody
Western Blot EXOC8 Antibody
Species: Hu
Applications: WB
Rab11A Antibody
NBP2-49320
Western Blot Rab11A Antibody
Immunohistochemistry-Paraffin Rab11A Antibody
Immunohistochemistry-Paraffin Rab11A Antibody
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SEC6 Recombinant
Protein Antigen
NBP2-55179PEP
SEC6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SEC6 Recombinant Protein Antigen (NBP2-55179PEP) (0)

There are no publications for SEC6 Recombinant Protein Antigen (NBP2-55179PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC6 Recombinant Protein Antigen (NBP2-55179PEP) (0)

There are no reviews for SEC6 Recombinant Protein Antigen (NBP2-55179PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SEC6 Recombinant Protein Antigen (NBP2-55179PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC6 Products

Blogs on SEC6

There are no specific blogs for SEC6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Glut4 Antibody - BSA Free
NBP1-49533

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SEC6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EXOC3