![Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SCP1-Antibody-Immunohistochemistry-Paraffin-NBP2-54674-img0003.jpg "Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining of human testis shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQEL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYCP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SCP1 Antibody (NBP2-54674)Find related products by research area.
|
|
Using SCP3/SYCP3 Antibodies as Meiosis Markers in Gametogenesis and DNA Repair Studies The synaptonemal complex (SC) is a protein structure that forms during the synapsis of homologous chromosomes during meiosis. This structure is involved in the processes of chromosome synapsis, genetic recombination and subsequent chromosome segregati... Read full blog post. |
|
SCP1 a Potential Cancer Target for Immunotherapy Synaptonemal Complex Protein 1 (SCP1) is a novel tumor antigen that belongs to the growing family of cancer/testis antigens (CTA). SCP-1 is known to be selectively expressed during the meiotic prophase of spermatocytes and is involved in the pairing o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYCP1 |
![Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/SCP1-Antibody-Immunohistochemistry-Paraffin-NBP2-54674-img0002.jpg "Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining in human testis and endometrium tissues using anti-SYCP1 antibody. Corresponding SYCP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SCP1-Antibody-Immunohistochemistry-Paraffin-NBP2-54674-img0004.jpg "Immunohistochemistry-Paraffin: SCP1 Antibody [NBP2-54674] - Staining in human testis and endometrium tissues using anti-SYCP1 antibody. Corresponding SYCP1 RNA-seq data are presented for the same tissues.")
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Flow_Cytometry_15135.jpg)
![Immunohistochemistry Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Immunohistochemistry_15186.jpg)
![Flow Cytometry Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Flow_Cytometry_15223.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")