Home » SAPS2 » SAPS2 Proteins » SAPS2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SAPS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SAPS2 Protein (NBP1-88014PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SAPS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP6R2.

Source: E. coli

Amino Acid Sequence: MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLLASFFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP6R2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88014.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAPS2 Recombinant Protein Antigen

  • dJ579N16.1
  • KIAA0685PP6R2SAPS2serine/threonine-protein phosphatase 6 regulatory subunit 2
  • protein phosphatase 6, regulatory subunit 2
  • SAP190
  • SAPS domain family member 2
  • SAPS domain family, member 2

Background

Protein phosphatase regulatory subunits, such as SAPS2, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS2 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SCAP2 Antibody
NBP2-47289
Immunocytochemistry/ Immunofluorescence SCAP2 Antibody
Western Blot SCAP2 Antibody
Immunohistochemistry-Paraffin SCAP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SAP155 Antibody
(6C7)
NBP3-26326
Immunohistochemistry SAP155 Antibody (6C7)
Immunohistochemistry SAP155 Antibody (6C7)
Western Blot SAP155 Antibody (6C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
SAPS3 Antibody
NBP2-34048
Immunocytochemistry/ Immunofluorescence SAPS3 Antibody
Immunohistochemistry-Paraffin SAPS3 Antibody
Immunohistochemistry-Paraffin SAPS3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western Blot Pentraxin 2/SAP Antibody [Unconjugated]
Simple Western Pentraxin 2/SAP Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: Simple Western, WB
SAPS1 Antibody
NBP2-48803
Immunocytochemistry/ Immunofluorescence SAPS1 Antibody
Western Blot SAPS1 Antibody
Immunohistochemistry-Paraffin SAPS1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPP6C Antibody
NBP2-13804
Western Blot PPP6C Antibody
Immunohistochemistry-Paraffin PPP6C Antibody
Immunohistochemistry-Paraffin PPP6C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
TMEM115 Antibody
NBP1-80898
Immunohistochemistry-Paraffin TMEM115 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone H2AX [p
Ser139] Antibody [Unc ...
AF2288
Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]
Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]
Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]
(24 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
IKBKAP Antibody
(6G9)
H00008518-M03
ELISA IKBKAP Antibody (6G9)
Immunohistochemistry-Paraffin IKBKAP Antibody (6G9)
Western Blot IKBKAP Antibody (6G9)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ROR
gamma/RORC/NR1F3 Anti ...
NBP2-24503
Immunohistochemistry-Paraffin ROR gamma/RORC/NR1F3 Antibody - BSA Free
Western Blot ROR gamma/RORC/NR1F3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ROR gamma/RORC/NR1F3 Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
DNA-PKcs Antibody
(3H6) - BSA Free
NBP2-22128
ELISA DNA-PKcs Antibody (3H6) - BSA Free
Western Blot DNA-PKcs Antibody (3H6) - BSA Free
Immunocytochemistry/ Immunofluorescence DNA-PKcs Antibody (3H6) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
IkB-epsilon
Antibody
NBP1-87762
Immunohistochemistry-Paraffin IkB-epsilon Antibody
Immunohistochemistry-Paraffin IkB-epsilon Antibody
Immunohistochemistry-Paraffin IkB-epsilon Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
KTI12 Antibody
NBP1-81176
Western Blot KTI12 Antibody
Immunohistochemistry-Paraffin KTI12 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
STAT2 [p Tyr690]
Antibody (1021D) [Unc ...
MAB2890
Simple Western STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
Flow Cytometry STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
(3 Publications)
Species: Hu
Applications: Flow, Simple Western, WB
PP4/PPP4C Antibody
(501517)
MAB5074
Western Blot PP4/PPP4C Antibody (501517)
(2 Publications)
Species: Hu
Applications: WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for SAPS2 Protein (NBP1-88014PEP) (0)

There are no publications for SAPS2 Protein (NBP1-88014PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAPS2 Protein (NBP1-88014PEP) (0)

There are no reviews for SAPS2 Protein (NBP1-88014PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAPS2 Protein (NBP1-88014PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAPS2 Products

Research Areas for SAPS2 Protein (NBP1-88014PEP)

Find related products by research area.

Blogs on SAPS2

There are no specific blogs for SAPS2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Adherent RAW cells treated with actinomycin-D, detached with a cell detachment solution and stained with the Annexin V Apoptosis Kit [FITC].
Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAPS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPP6R2