![Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/S100A6-Antibody-0J1Q5-Western-Blot-NBP3-16191-img0004.jpg "Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 0J1Q5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (P06703). MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | S100A6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 10 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for S100A6 Antibody (NBP3-16191)Find related products by research area.
|
|
S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | S100A6 |
![Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Human liver using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/S100A6-Antibody-0J1Q5-Immunohistochemistry-Paraffin-NBP3-16191-img0002.jpg "Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Human liver using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/S100A6-Antibody-0J1Q5-Western-Blot-NBP3-16191-img0005.jpg "Western Blot: S100A6 Antibody (0J1Q5) [NBP3-16191] - Analysis of extracts of various cell lines, using S100A6 Rabbit mAb (NBP3-16191) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Rat spleen using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/S100A6-Antibody-0J1Q5-Immunohistochemistry-Paraffin-NBP3-16191-img0001.jpg "Immunohistochemistry-Paraffin: S100A6 Antibody (0J1Q5) [NBP3-16191] - Rat spleen using S100A6 Rabbit mAb (NBP3-16191) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: S100A6 Antibody (0J1Q5) [NBP3-16191] -Confocal imaging of C2C12 cellsusing S100A6 Rabbit mAb dilution1:400) followed by a further incubationwith Cy3 Goat Anti-Rabbit IgG (H+L)(dilution 1:500) (Red). The cellswere counterstained with alpha -Tubulin MousemAb (AC012, dilution 1:400) followed byincubation with ABflo® 488-conjugatedGoat Anti-Mouse IgG (H+L) Abdilution 1:500) (Green). DAPI was used fornuclear staining (Blue). Objective: 100x](http://images.novusbio.com/fullsize/nbp3-16191_rabbit-s100a6-mab-0j1q5-immunocytochemistry-immunofluorescence-154202412616..jpg "Immunocytochemistry/Immunofluorescence: S100A6 Antibody (0J1Q5) [NBP3-16191] -Confocal imaging of C2C12 cellsusing S100A6 Rabbit mAb dilution1:400) followed by a further incubationwith Cy3 Goat Anti-Rabbit IgG (H+L)(dilution 1:500) (Red). The cellswere counterstained with alpha -Tubulin MousemAb (AC012, dilution 1:400) followed byincubation with ABflo® 488-conjugatedGoat Anti-Mouse IgG (H+L) Abdilution 1:500) (Green). DAPI was used fornuclear staining (Blue). Objective: 100x")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")