RPGRIP1 Antibody (5H2) Summary
Immunogen |
RPGRIP1 (NP_065099.2, 1187 a.a. ~ 1286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTEDLFS |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
RPGRIP1 |
Purity |
Protein A or G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
Reactivity Notes
Human. Does not work on mouse for immunocytochemistry (as per customer feedback).
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RPGRIP1 Antibody (5H2)
Background
The RPGRIP1 gene encodes a photoreceptor protein that interacts with retinitis pigmentosa GTPase regulator protein and is akey component of cone and rod photoreceptor cells. Mutations in this gene lead to autosomal recessive congenitalblindness. (provided by Ref
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB, ELISA
Publications for RPGRIP1 Antibody (H00057096-M01-100ug) (0)
There are no publications for RPGRIP1 Antibody (H00057096-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPGRIP1 Antibody (H00057096-M01-100ug) (0)
There are no reviews for RPGRIP1 Antibody (H00057096-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPGRIP1 Antibody (H00057096-M01-100ug). (Showing 1 - 1 of 1 FAQ).
-
Do you know if it has reactivity in mouse?
- The homology/blast results for the immunogen of H00057096-M01 shows 76% similarity with mouse RPGRIP1 protein. Typically, we believe that if the homology is greater than 80%, than it should work. In this case if you are struggling to find one that will work in mouse and would like to test this antibody, we do offer our Innovators reward program. You can read more about our Innovator's Reward program.
Secondary Antibodies
| |
Isotype Controls
|
Additional RPGRIP1 Products
Array H00057096-M01-100ug
Research Areas for RPGRIP1 Antibody (H00057096-M01-100ug)
Find related products by research area.
|
Blogs on RPGRIP1