Novus Biologicals products are now on bio-techne.com

ROCK1 Recombinant Protein Antigen

Images

 
There are currently no images for ROCK1 Protein (NBP1-82450PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ROCK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROCK1.

Source: E. coli

Amino Acid Sequence: TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ROCK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82450.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROCK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • MGC131603
  • MGC43611
  • p160 ROCK-1
  • p160ROCK
  • p160-ROCK
  • PRO0435
  • Renal carcinoma antigen NY-REN-35
  • Rho kinase
  • rho-associated protein kinase 1
  • Rho-associated, coiled-coil containing protein kinase 1
  • Rho-associated, coiled-coil-containing protein kinase 1
  • ROCK1
  • ROK beta

Background

Rho-associated kinase I (ROCK1, ROK beta, p160ROCK) is a serine-threonine protein kinase and an effector of the small GTPase Rho. With N-terminus protein kinase domain and C-terminus Rho-binding domain/pleckstrin homology domain, ROCK1 can be activated by either RhoA or RhoB. In Rho specific ROCK1 activation, a Rho protein binds to the Rho-binding domain and induces a conformational change which opens the kinase domain for the phosphorylation of downstream effectors (1). Activated ROCK1 phosphorylates various signaling proteins, such as myosin light chain phosphatase, LIM kinases, and ezrin-radixin-moesin proteins. Caspase-3 also activates ROCK1; Caspase-3 cleaves ROCK1 at DETD1113/G sequence and removes its inhibitory c-terminal domain. This activation, independent of Rho activity, leads to apoptotic membrane blebbing (2). ROCK1 is involved in regulating actin cytoskeleton assembly, cell migration, centromere positing, smooth muscle contraction, and neurite outgrowth. Its involvement in tumor invasion, hypertension, and bronchial asthma makes ROCK1 an ideal target for drug development (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-38889
Species: Hu
Applications: IP, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-82450PEP
Species: Hu
Applications: AC

Publications for ROCK1 Protein (NBP1-82450PEP) (0)

There are no publications for ROCK1 Protein (NBP1-82450PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROCK1 Protein (NBP1-82450PEP) (0)

There are no reviews for ROCK1 Protein (NBP1-82450PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ROCK1 Protein (NBP1-82450PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROCK1 Products

Research Areas for ROCK1 Protein (NBP1-82450PEP)

Find related products by research area.

Blogs on ROCK1.

TGF-beta for treating degenerative intervertebral disc disease
By Jamshed Arslan Pharm.D. Our upright posture and balance depend on a jelly-like material, called nucleus pulposus (NP), in the middle of intervertebral discs. NP cells protect us from disc degeneration by maintain...  Read full blog post.

A good helper on validating your FLOW and IHC data - Rabbit IgG Isotype Control
Isotype controls are primarily used as negative controls in flow cytometry but they can also be used for immunohistochemistry. They are used to approximate the non-specific target primary antibody binding due to protein-protein interactions, binding t...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ROCK1 Antibody
NB100-624

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ROCK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ROCK1