I would like to know the expression host of the RNA Helicase A product H00001660-Q10

Name: Recombinant Human RNA Helicase A GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001660-Q01
Price: 589 USD

Question

Accepted Answer

This product is distributed by Novus for a Taiwanese company called Abnova. Their proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-translational modifications they might undergo in an endogenous cell. Due to this production system, we do not suggest these proteins for use in functional assays (unless recommend on the datasheet) and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-90 of Human RNA Helicase A Source: Wheat Germ (in vitro) Amino Acid Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	DHX9
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	35.64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human RNA Helicase A GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human RNA Helicase A GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human RNA Helicase A GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RNA Helicase A Partial Recombinant Protein (H00001660-Q01) (0)

Reviews for RNA Helicase A Partial Recombinant Protein (H00001660-Q01) (0)

Product General Protocols

Video Protocols

FAQs for RNA Helicase A Partial Recombinant Protein (H00001660-Q01). (Showing 1 - 1 of 1 FAQ).

Additional RNA Helicase A Products

Research Areas for RNA Helicase A Partial Recombinant Protein (H00001660-Q01)

Blogs on RNA Helicase A

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics