![Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/RFC2-Antibody-Western-Blot-NBP1-89341-img0006.jpg "Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RFC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89341 | Applications | Species |
|---|---|---|
| Zhao X, Wang y, Li J et al. RFC2: a prognosis biomarker correlated with the immune signature in diffuse lower-grade gliomas Scientific reports 2022-02-24 [PMID: 35210438] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for RFC2 Antibody (NBP1-89341)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RFC2 |
![Immunocytochemistry/Immunofluorescence: RFC2 Antibody [NBP1-89341] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/RFC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89341-img0007.jpg "Immunocytochemistry/Immunofluorescence: RFC2 Antibody [NBP1-89341] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: RFC2 Antibody [NBP1-89341] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RFC2-Antibody-Immunohistochemistry-Paraffin-NBP1-89341-img0002.jpg "Immunohistochemistry-Paraffin: RFC2 Antibody [NBP1-89341] - Staining of human vulva/anal skin shows strong nuclear positivity in squamous epithelial cells.")
![Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/RFC2-Antibody-Western-Blot-NBP1-89341-img0005.jpg "Western Blot: RFC2 Antibody [NBP1-89341] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry: RFC2 Antibody [NBP1-89341] - RFC2 expression correlated with clinicopathological features in our LGG samples. The immunohistochemistry images showing the relative expression of RFC2 in LGG tissues and benign brain tumor tissues (Original magnification, x 400). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35210438/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp1-89341_rabbit-polyclonal-rfc2-antibody-2552023151492.jpg "Immunohistochemistry: RFC2 Antibody [NBP1-89341] - RFC2 expression correlated with clinicopathological features in our LGG samples. The immunohistochemistry images showing the relative expression of RFC2 in LGG tissues and benign brain tumor tissues (Original magnification, x 400). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35210438/) licensed under a CC-BY license.")
![Immunohistochemistry: RFC2 Antibody [NBP1-89341] - Comparison of RFC2 expression between tumor & normal tissues (left, red represented tumor tissues while blue represented normal tissues) & corresponding immunohistochemistry images in normal tissues (middle) & tumor tissues (right). (A–F) The differential expression levels of RFC2 in glioblastoma (GBM) tissues (A), diffuse lower-grade gliomas (LGG) tissues (B), cervical cancer (CESC) tissues (C), colon adenocarcinoma (COAD) tissues (D), liver hepatocellular carcinoma (LIHC) tissues (E), lung squamous cell carcinoma (LUSC) tissues (F), & their corresponding normal tissues were evaluated based on GEPIA & HPA databases. (*P < 0.05). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35210438), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89341_rabbit-polyclonal-rfc2-antibody-3102024153567.jpg "Immunohistochemistry: RFC2 Antibody [NBP1-89341] - Comparison of RFC2 expression between tumor & normal tissues (left, red represented tumor tissues while blue represented normal tissues) & corresponding immunohistochemistry images in normal tissues (middle) & tumor tissues (right). (A–F) The differential expression levels of RFC2 in glioblastoma (GBM) tissues (A), diffuse lower-grade gliomas (LGG) tissues (B), cervical cancer (CESC) tissues (C), colon adenocarcinoma (COAD) tissues (D), liver hepatocellular carcinoma (LIHC) tissues (E), lung squamous cell carcinoma (LUSC) tissues (F), & their corresponding normal tissues were evaluated based on GEPIA & HPA databases. (*P < 0.05). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35210438), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")