Home » Recoverin » Recoverin Proteins » Recoverin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Recoverin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Recoverin Recombinant Protein Antigen (NBP2-58802PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recoverin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Recoverin.

Source: E. coli

Amino Acid Sequence: SIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RCVRN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58802.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Recoverin Recombinant Protein Antigen

  • cancer associated retinopathy antigen
  • Protein CAR
  • RCV1Cancer-associated retinopathy protein
  • recoverin

Background

Calcium binding proteins are implicated as being a helper molecule in aberrant tissue growth of tumors. Recoverin is a neurologically important calcium binding protein involved in tumor pathology. It is conserved across species and there are indications of several isoforms of this molecule. Recoverin antibodies are a useful tool for distinguishing between pineal gland-derived tissue and the surrounding tissue of the brain. They can also be used to accurately determine malignant tissue in this location of the brain. In pineal tumor tissue, the normal tissue staining pattern is lost, indicating the tissue's loss of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Hippocalcin
Antibody
H00003208-B01P
Western Blot Hippocalcin Antibody
Immunocytochemistry/ Immunofluorescence Hippocalcin Antibody
Species: Hu
Applications: ICC/IF, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
GRK1 Antibody
NBP2-55226
Immunohistochemistry-Paraffin GRK1 Antibody
Immunohistochemistry-Paraffin GRK1 Antibody
Immunohistochemistry-Paraffin GRK1 Antibody
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Arrestin 3 Antibody
NBP1-37003
Immunohistochemistry-Paraffin Arrestin 3 Antibody
Immunohistochemistry-Paraffin Arrestin 3 Antibody
(9 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
(1 Review)
(21 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SPG7 Antibody
(OTI1C1)
NBP2-01860
Western Blot SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
Flow Cytometry SPG7 Antibody (OTI1C1)
(1 Review)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CXADR Antibody
[Unconjugated]
AF2654
Western Blot CXADR Antibody [Unconjugated]
Simple Western CXADR Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
TRIM13 Antibody
NBP1-85016
Western Blot TRIM13 Antibody
Immunohistochemistry-Paraffin TRIM13 Antibody
Immunohistochemistry-Paraffin TRIM13 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
GCAP1 Antibody
NBP2-55158
Immunohistochemistry-Paraffin GCAP1 Antibody
Immunohistochemistry-Paraffin GCAP1 Antibody
Immunohistochemistry-Paraffin GCAP1 Antibody
(1 Publication)
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Recoverin
Recombinant Protein A
NBP2-58802PEP
Recoverin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Recoverin Recombinant Protein Antigen (NBP2-58802PEP) (0)

There are no publications for Recoverin Recombinant Protein Antigen (NBP2-58802PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Recoverin Recombinant Protein Antigen (NBP2-58802PEP) (0)

There are no reviews for Recoverin Recombinant Protein Antigen (NBP2-58802PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Recoverin Recombinant Protein Antigen (NBP2-58802PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recoverin Products

Research Areas for Recoverin Recombinant Protein Antigen (NBP2-58802PEP)

Find related products by research area.

Blogs on Recoverin

There are no specific blogs for Recoverin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141
Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
NB120-19347

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Recoverin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RCVRN