![Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human colon, eye, retina, liver and lymph node using Anti-GRK1 antibody NBP2-55226 (A) shows similar protein distribution across tissues to independent antibody NBP2-55732 (B).](http://images.novusbio.com/fullsize/GRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-55226-img0008.jpg "Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human colon, eye, retina, liver and lymph node using Anti-GRK1 antibody NBP2-55226 (A) shows similar protein distribution across tissues to independent antibody NBP2-55732 (B).")
| Reactivity | Hu, PmSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GRK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot GRK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRK2_AF4339_Western_Blot_5441.jpg)
![Knockout Validated GRK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRK2_AF4339_Knockout_Validated_22898.jpg)
![Immunohistochemistry GRK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRK2_AF4339_Immunohistochemistry_7336.jpg)
| Publication using NBP2-55226 | Applications | Species |
|---|---|---|
| Yamasaki S, Tu H, Matsuyama T et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation iScience 2022-01-01 [PMID: 35024589] (IHC-Fr, Monkey) | IHC-Fr | Monkey |
Secondary Antibodies |
Isotype Controls |
Research Areas for GRK1 Antibody (NBP2-55226)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GRK1 |
![Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human eye, retina.](http://images.novusbio.com/fullsize/GRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-55226-img0009.jpg "Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human eye, retina.")
![Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human lymph node.](http://images.novusbio.com/fullsize/GRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-55226-img0004.jpg "Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human liver.](http://images.novusbio.com/fullsize/GRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-55226-img0005.jpg "Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human liver.")
![Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human colon.](http://images.novusbio.com/fullsize/GRK1-Antibody-Immunohistochemistry-Paraffin-NBP2-55226-img0006.jpg "Immunohistochemistry-Paraffin: GRK1 Antibody [NBP2-55226] - Staining of human colon.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")