![Immunocytochemistry/Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/REC8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87145-img0001.jpg "Immunocytochemistry/Immunofluorescence: REC8 Antibody [NBP1-87145] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | REC8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for REC8 Antibody (NBP1-87145)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | REC8 |
![Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skin shows very weak positivity in squamous epthelial cells.](http://images.novusbio.com/fullsize/REC8-Antibody-Immunohistochemistry-Paraffin-NBP1-87145-img0005.jpg "Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skin shows very weak positivity in squamous epthelial cells.")
![Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.](http://images.novusbio.com/fullsize/REC8-Antibody-Immunohistochemistry-Paraffin-NBP1-87145-img0002.jpg "Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/REC8-Antibody-Immunohistochemistry-Paraffin-NBP1-87145-img0003.jpg "Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human liver shows negative no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/REC8-Antibody-Immunohistochemistry-Paraffin-NBP1-87145-img0004.jpg "Immunohistochemistry-Paraffin: REC8 Antibody [NBP1-87145] - Staining of human liver shows negative no positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")