![Western Blot: RCN3 Antibody [NBP2-38627] - Analysis in human cell line AN3-CA.](http://images.novusbio.com/fullsize/RCN3-Antibody-Western-Blot-NBP2-38627-img0005.jpg "Western Blot: RCN3 Antibody [NBP2-38627] - Analysis in human cell line AN3-CA.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDL |
| Predicted Species | Mouse (93%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RCN3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RCN3 Antibody (NBP2-38627)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RCN3 Antibody [NBP2-38627] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RCN3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38627-img0004.jpg "Immunocytochemistry/Immunofluorescence: RCN3 Antibody [NBP2-38627] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/RCN3-Antibody-Immunohistochemistry-Paraffin-NBP2-38627-img0009.jpg "Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human skin shows moderate cytoplasmic positivity in fibroblasts.](http://images.novusbio.com/fullsize/RCN3-Antibody-Immunohistochemistry-Paraffin-NBP2-38627-img0006.jpg "Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human skin shows moderate cytoplasmic positivity in fibroblasts.")
![Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human testis shows moderate to strong cytoplasmic an nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RCN3-Antibody-Immunohistochemistry-Paraffin-NBP2-38627-img0007.jpg "Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human testis shows moderate to strong cytoplasmic an nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human upper gastrointestinal shows moderate cytoplasmic positivity in cells in lamina propria.](http://images.novusbio.com/fullsize/RCN3-Antibody-Immunohistochemistry-Paraffin-NBP2-38627-img0008.jpg "Immunohistochemistry-Paraffin: RCN3 Antibody [NBP2-38627] - Staining of human upper gastrointestinal shows moderate cytoplasmic positivity in cells in lamina propria.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")