Home » RBP4/Retinol-Binding Protein 4 » RBP4/Retinol-Binding Protein 4 Proteins » RBP4/Retinol-Binding Protein 4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RBP4/Retinol-Binding Protein 4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RBP4/Retinol-Binding Protein 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBP4.

Source: E. coli

Amino Acid Sequence: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86173.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBP4/Retinol-Binding Protein 4 Recombinant Protein Antigen

  • interstitial
  • Plasma retinol-binding protein
  • RBP4
  • retinol binding protein 4, plasma
  • RetinolBinding Protein 4
  • retinol-binding protein 4, plasma

Background

RBP4 is a specific carrier for retinol in the blood. It is a member of the lipocalin protein family. Under physiological conditions, RBP binds transthyretin (TTR) to prevent glomerular filtration of low molecular weight RBP in the kidneys. The RBP/TTR molar ration provides an indirect way to indicate marginal vitamin A deficiency. RBP4 may also play a role in insulin resistance in diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(187 Publications)
Species: Hu
Applications: ELISA
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(70 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(670 Publications)
Species: Mu
Applications: ELISA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(156 Publications)
Species: Hu
Applications: ELISA
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(51 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Retinol Binding
Protein RBP Antibody ...
NBP2-00637
Flow Cytometry Retinol Binding Protein RBP Antibody (OTI2H3)
Flow Cytometry Retinol Binding Protein RBP Antibody (OTI2H3)
Western Blot Retinol Binding Protein RBP Antibody (OTI2H3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

PBEF/Visfatin/NAMPT An
NB100-594
Western Blot PBEF/Visfatin/NAMPT Antibody
Western Blot PBEF/Visfatin/NAMPT Antibody
Immunohistochemistry-Paraffin PBEF/Visfatin/NAMPT Antibody
(10 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB

alpha-N-acetylglucosam ...
NBP1-31555
Immunocytochemistry/ Immunofluorescence alpha-N-acetylglucosaminidase/NAGLU Antibody
Immunocytochemistry/ Immunofluorescence alpha-N-acetylglucosaminidase/NAGLU Antibody
Immunohistochemistry-Paraffin alpha-N-acetylglucosaminidase/NAGLU Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NAG Antibody - BSA
Free
NBP2-93277
Western Blot NAG Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NAG Antibody - BSA Free
Species: Hu, Rt
Applications: ICC/IF, WB
SCN7A Antibody
NB100-81029
Immunohistochemistry-Paraffin SCN7A Antibody
Immunocytochemistry/ Immunofluorescence SCN7A Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Resistin [HRP]
DRSN00
N/A Resistin [HRP]
N/A Resistin [HRP]
(45 Publications)
Species: Hu
Applications: ELISA
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP) (0)

There are no publications for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP) (0)

There are no reviews for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBP4/Retinol-Binding Protein 4 Products

Research Areas for RBP4/Retinol-Binding Protein 4 Protein (NBP1-86173PEP)

Find related products by research area.

Blogs on RBP4/Retinol-Binding Protein 4

There are no specific blogs for RBP4/Retinol-Binding Protein 4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBP4/Retinol-Binding Protein 4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RBP4