![Immunocytochemistry/Immunofluorescence: RBM22 Antibody [NBP1-85379] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RBM22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85379-img0006.jpg "Immunocytochemistry/Immunofluorescence: RBM22 Antibody [NBP1-85379] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM22 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM22 |
![Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human tonsil shows strong nuclear positivity in non-germinal and germinal center cells.](http://images.novusbio.com/fullsize/RBM22-Antibody-Immunohistochemistry-Paraffin-NBP1-85379-img0010.jpg "Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human tonsil shows strong nuclear positivity in non-germinal and germinal center cells.")
![Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/RBM22-Antibody-Immunohistochemistry-Paraffin-NBP1-85379-img0007.jpg "Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM22-Antibody-Immunohistochemistry-Paraffin-NBP1-85379-img0008.jpg "Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules and glomeruli.](http://images.novusbio.com/fullsize/RBM22-Antibody-Immunohistochemistry-Paraffin-NBP1-85379-img0009.jpg "Immunohistochemistry-Paraffin: RBM22 Antibody [NBP1-85379] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules and glomeruli.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")