![Western Blot: DHX8 Antibody [NBP2-13923] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/DHX8-Antibody-Western-Blot-NBP2-13923-img0004.jpg "Western Blot: DHX8 Antibody [NBP2-13923] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DHX8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [Unconjugated]](https://images.novusbio.com/images2/CHRM3_MAB6378_Flow_Cytometry_24142.jpg)
![Immunohistochemistry Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [Unconjugated]](https://images.novusbio.com/images2/mab6378_human-chrm3-mab-clone-580011-immunohistochemistry-352020175913.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DHX8 |
![Immunocytochemistry/Immunofluorescence: DHX8 Antibody [NBP2-13923] - Staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13923-img0002.jpg "Immunocytochemistry/Immunofluorescence: DHX8 Antibody [NBP2-13923] - Staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunohistochemistry-Paraffin-NBP2-13923-img0007.jpg "Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunohistochemistry-Paraffin-NBP2-13923-img0001.jpg "Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunohistochemistry-Paraffin-NBP2-13923-img0005.jpg "Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunohistochemistry-Paraffin-NBP2-13923-img0006.jpg "Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/DHX8-Antibody-Immunohistochemistry-Paraffin-NBP2-13923-img0008.jpg "Immunohistochemistry-Paraffin: DHX8 Antibody [NBP2-13923] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")