![Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/PHF5A-Antibody-Western-Blot-NBP1-88591-img0010.jpg "Western Blot: PHF5A Antibody [NBP1-88591] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PHF5A antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERK |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PHF5A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PHF5A Antibody (NBP1-88591)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PHF5A |
![Immunocytochemistry/Immunofluorescence: PHF5A Antibody [NBP1-88591] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PHF5A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88591-img0009.jpg "Immunocytochemistry/Immunofluorescence: PHF5A Antibody [NBP1-88591] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PHF5A-Antibody-Immunohistochemistry-Paraffin-NBP1-88591-img0014.jpg "Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/PHF5A-Antibody-Immunohistochemistry-Paraffin-NBP1-88591-img0011.jpg "Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human cerebral cortex shows strong nuclear positivity in neurons](http://images.novusbio.com/fullsize/PHF5A-Antibody-Immunohistochemistry-Paraffin-NBP1-88591-img0012.jpg "Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human cerebral cortex shows strong nuclear positivity in neurons")
![Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PHF5A-Antibody-Immunohistochemistry-Paraffin-NBP1-88591-img0013.jpg "Immunohistochemistry-Paraffin: PHF5A Antibody [NBP1-88591] - Staining of human rectum shows strong nuclear positivity in glandular cells.")
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")