![Western Blot: RASD2 Antibody [NBP1-82775] - Analysis in control (vector only transfected HEK293T lysate) and RASD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RASD2-Antibody-Western-Blot-NBP1-82775-img0012.jpg "Western Blot: RASD2 Antibody [NBP1-82775] - Analysis in control (vector only transfected HEK293T lysate) and RASD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: DTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLR |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RASD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse and Rat | 05/03/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RASD2 Antibody (NBP1-82775)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RASD2 |
![Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining in human prostate and pancreas tissues using anti-RASD2 antibody. Corresponding RASD2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RASD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82775-img0011.jpg "Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining in human prostate and pancreas tissues using anti-RASD2 antibody. Corresponding RASD2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/RASD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82775-img0009.jpg "Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining of human prostate shows high expression.](http://images.novusbio.com/fullsize/RASD2-Antibody-Immunohistochemistry-Paraffin-NBP1-82775-img0010.jpg "Immunohistochemistry-Paraffin: RASD2 Antibody [NBP1-82775] - Staining of human prostate shows high expression.")
![Western Blot Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Western_Blot_13010.jpg)
![Immunohistochemistry Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Immunohistochemistry_14734.jpg)
![ELISA Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/af7947_human-mouse-rat-neurogranin-affinity-purified-polyclonal-ab-elisa-27102022104024.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot DARPP-32 Antibody (375604) [Unconjugated]](https://images.novusbio.com/images2/DARPP-32_MAB4230_Western_Blot_6161.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
