![Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of C6 cells, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/Rad21-Antibody-Western-Blot-NBP3-15608-img0006.jpg "Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of C6 cells, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-420 of human Rad21 (NP_006256.1). VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAD21 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Rad21 Antibody (NBP3-15608)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAD21 |
![Immunocytochemistry/Immunofluorescence: Rad21 Antibody [NBP3-15608] - Immunofluorescence analysis of U2OS cells using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Rad21-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-15608-img0004.jpg "Immunocytochemistry/Immunofluorescence: Rad21 Antibody [NBP3-15608] - Immunofluorescence analysis of U2OS cells using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded rat stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Rad21-Antibody-Immunohistochemistry-Paraffin-NBP3-15608-img0003.jpg "Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded rat stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Chromatin Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (NBP3-15608) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/Rad21-Antibody-Chromatin-Immunoprecipitation-NBP3-15608-img0008.jpg "Chromatin Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (NBP3-15608) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of various cell lines, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/Rad21-Antibody-Western-Blot-NBP3-15608-img0005.jpg "Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of various cell lines, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Rad21-Antibody-Immunohistochemistry-Paraffin-NBP3-15608-img0001.jpg "Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded mouse stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Rad21-Antibody-Immunohistochemistry-Paraffin-NBP3-15608-img0002.jpg "Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded mouse stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Rad21 antibody (NBP3-15608). Western blot was performed from the immunoprecipitate using Rad21 antibody (NBP3-15608) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/Rad21-Antibody-Immunoprecipitation-NBP3-15608-img0007.jpg "Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Rad21 antibody (NBP3-15608). Western blot was performed from the immunoprecipitate using Rad21 antibody (NBP3-15608) at a dilition of 1:1000.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")