![Western Blot: Rad21 Antibody (9H0H6) [NBP3-15892] - Western blot analysis of extracts of various cell lines, using Rad21 Rabbit mAb (NBP3-15892) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Rad21-Antibody-9H0H6-Western-Blot-NBP3-15892-img0001.jpg "Western Blot: Rad21 Antibody (9H0H6) [NBP3-15892] - Western blot analysis of extracts of various cell lines, using Rad21 Rabbit mAb (NBP3-15892) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ChIP |
| Clone | 9H0H6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RAD21 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Rad21 Antibody (NBP3-15892)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAD21 |
![Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/nbp3-15892_rabbit-rad21-mab-9h0h6-52202517235745.jpg "Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of Rad21 across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in Rad21 (lower panel).](http://images.novusbio.com/fullsize/nbp3-15892_rabbit-rad21-mab-9h0h6-52202517223983.jpg "Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of Rad21 across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in Rad21 (lower panel).")
![Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of Rad21 in the representative genomic region surrounding MYC gene.](http://images.novusbio.com/fullsize/nbp3-15892_rabbit-rad21-mab-9h0h6-52202517192964.jpg "Chromatin Immunoprecipitation: Rad21 Antibody (9H0H6) [Rad21] - Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of Rad21 in the representative genomic region surrounding MYC gene.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")