![Western Blot: RAB38 Antibody (7F1) [H00023682-M02] - RAB38 monoclonal antibody (M02), clone 7F1 Analysis of RAB38 expression in A-431.](http://images.novusbio.com/fullsize/RAB38-Antibody-7F1-Western-Blot-H00023682-M02-img0004.jpg "Western Blot: RAB38 Antibody (7F1) [H00023682-M02] - RAB38 monoclonal antibody (M02), clone 7F1 Analysis of RAB38 expression in A-431.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 7F1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | RAB38 (NP_071732, 115 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS |
| Localization | Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). Melanosome. |
| Specificity | RAB38 - RAB38, member RAS oncogene family |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RAB38 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB38 Antibody (H00023682-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: RAB38 Antibody (7F1) [H00023682-M02] - Detection limit for recombinant GST tagged RAB38 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RAB38-Antibody-7F1-Sandwich-ELISA-H00023682-M02-img0003.jpg "Sandwich ELISA: RAB38 Antibody (7F1) [H00023682-M02] - Detection limit for recombinant GST tagged RAB38 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![N/A Lipocalin-2/NGAL [Biotin]](https://images.novusbio.com/images2/DATA_Lipocalin2_DY1857_ELISA_2306.jpg)
