![Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Western-Blot-H00027339-M07-img0008.jpg "Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in NIH/3T3 (Cat # L018V1).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF |
| Specificity | PRPF19 (2E5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PRPF19 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
||
| Control |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRP19 Antibody (H00027339-M07)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of monoclonal antibody to PRPF19 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Immunocytochemistry-Immunofluorescence-H00027339-M07-img0004.jpg "Immunocytochemistry/Immunofluorescence: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of monoclonal antibody to PRPF19 on HeLa cell. Antibody concentration 10 ug/ml")
![Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Western-Blot-H00027339-M07-img0006.jpg "Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in PC-12 (Cat # L012V1).")
![Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Western-Blot-H00027339-M07-img0007.jpg "Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in Hela S3 NE (Cat # L013V3).")
![Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in transfected 293T cell line by PRPF19 monoclonal antibody (M07), clone 2E5. Lane 1: PRPF19 transfected lysatE (55.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Western-Blot-H00027339-M07-img0009.jpg "Western Blot: PRP19 Antibody (2E5) [H00027339-M07] - Analysis of PRPF19 expression in transfected 293T cell line by PRPF19 monoclonal antibody (M07), clone 2E5. Lane 1: PRPF19 transfected lysatE (55.2 KDa). Lane 2: Non-transfected lysate.")
![Sandwich ELISA: PRP19 Antibody (2E5) [H00027339-M07] - Detection limit for recombinant GST tagged PRPF19 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PRP19-Antibody-2E5-Sandwich-ELISA-H00027339-M07-img0005.jpg "Sandwich ELISA: PRP19 Antibody (2E5) [H00027339-M07] - Detection limit for recombinant GST tagged PRPF19 is 0.3 ng/ml as a capture antibody.")
