Sandwich ELISA: PRA1 Antibody (2A4) [H00010567-M01] - Detection limit for recombinant GST tagged RABAC1 is approximately 0.3ng/ml as a capture antibody.
RABAC1 (NP_006414.1, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSN
Specificity
RABAC1 - Rab acceptor 1 (prenylated) (2A4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RABAC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 23813961)
Publications
Read Publication using H00010567-M01 in the following applications:
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PRA1 Antibody (2A4)
PRA1 family protein 1
PRA1PRA1 domain family 1
PRAF1prenylated Rab acceptor 1
prenylated Rab acceptor protein 1
Rab acceptor 1 (prenylated)
YIP3
Background
PRA1 (prenylated Rab acceptor) is a general regulator of Rab proteins. It has been shown that PRA1 interacts with Rab proteins and with VAMP2. Therefore PRA1 is probably an important factor for membrane traffic, linking together the function of Rab proteins and SNAREs (1). Human cells contain more than 60 small G proteins of the Rab family, which are localized to the surfaces of distinct membrane compartments and regulate transport vesicle formation, motility, docking and fusion. Prenylated Rabs also occur in the cytosol bound to GDI (guanine nucleotide dissociation inhibitor), which binds to Rabs in their inactive state (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PRA1 Antibody (2A4) and receive a gift card or discount.