![Immunocytochemistry/Immunofluorescence: PPM1E Antibody [NBP1-86649] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86649-img0004.jpg "Immunocytochemistry/Immunofluorescence: PPM1E Antibody [NBP1-86649] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEI |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPM1E |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PPM1E Antibody (NBP1-86649)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPM1E |
![Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunohistochemistry-Paraffin-NBP1-86649-img0007.jpg "Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.")
![Immunocytochemistry/Immunofluorescence: PPM1E Antibody [NBP1-86649] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86649-img0003.jpg "Immunocytochemistry/Immunofluorescence: PPM1E Antibody [NBP1-86649] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.")
![Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human cerebellum shows distinct nucleolar and nuclear positivity in Purkinje cells and in cells in molecular layer..](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunohistochemistry-Paraffin-NBP1-86649-img0001.jpg "Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human cerebellum shows distinct nucleolar and nuclear positivity in Purkinje cells and in cells in molecular layer..")
![Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunohistochemistry-Paraffin-NBP1-86649-img0005.jpg "Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/PPM1E-Antibody-Immunohistochemistry-Paraffin-NBP1-86649-img0006.jpg "Immunohistochemistry-Paraffin: PPM1E Antibody [NBP1-86649] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")