Home » PPIL4 » PPIL4 Proteins » PPIL4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PPIL4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PPIL4 Protein (NBP1-85921PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PPIL4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIL4.

Source: E. coli

Amino Acid Sequence: KVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPIL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85921.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPIL4 Recombinant Protein Antigen

  • Cyclophilin-like protein PPIL4
  • cyclophilin-type peptidyl-prolyl cis-trans isomerase
  • EC 5.2.1.8
  • HDCME13P
  • peptidyl-prolyl cis-trans isomerase-like 4
  • peptidylprolyl isomerase (cyclophilin)-like 4
  • PPIase
  • Rotamase PPIL4
  • serologically defined breast cancer antigen NY-BR-18

Background

PPIL4 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclophilin A
Antibody
NBP1-30993
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
(2 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PPIL1 Antibody
(OTI2D1)
NBP2-45382
Western Blot PPIL1 Antibody (OTI2D1)
Immunohistochemistry PPIL1 Antibody (OTI2D1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Cyclophilin A
Antibody
NBP1-30993
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
(2 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
FKBP12 Antibody
(422513)
MAB3777
Western Blot FKBP12 Antibody (422513)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western Blot PDZD2/PDZK3 Antibody (787924)
Immunocytochemistry PDZD2/PDZK3 Antibody (787924)
Species: Hu
Applications: ICC, WB
Pin1 Antibody
(257417) [Unconjugate
MAB2294
Western Blot Pin1 Antibody (257417) [Unconjugated]
Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]
Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA FKBP52/FKBP4 Antibody (5C11)
Western Blot FKBP52/FKBP4 Antibody (5C11)
Immunohistochemistry-Paraffin FKBP52/FKBP4 Antibody (5C11)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western Blot FKBP51/FKBP5 Antibody [Unconjugated]
Simple Western FKBP51/FKBP5 Antibody [Unconjugated]
Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Cyclophilin 40
Antibody (PSH02-71)
NBP3-32238
Western Blot Cyclophilin 40 Antibody (PSH02-71)
Immunohistochemistry Cyclophilin 40 Antibody (PSH02-71)
Immunocytochemistry/ Immunofluorescence Cyclophilin 40 Antibody (PSH02-71)
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cyclophilin C
Antibody (3C6) - BSA
NBP1-97946
Western Blot Cyclophilin C Antibody (3C6) - BSA Free
Flow Cytometry Cyclophilin C Antibody (3C6) - BSA Free
Immunocytochemistry/ Immunofluorescence Cyclophilin C Antibody (3C6) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
FKBP13/FKBP2
Antibody (422617)
MAB4356
Western Blot FKBP13/FKBP2 Antibody (422617)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB
PPIG Antibody (4F8)
H00009360-M02
Immunocytochemistry/ Immunofluorescence PPIG Antibody (4F8)
Sandwich ELISA PPIG Antibody (4F8)
Immunohistochemistry-Paraffin PPIG Antibody (4F8)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSP90 alpha
Antibody
NB120-2928
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry-Paraffin HSP90 alpha Antibody
(13 Publications)
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
MIPEP Antibody
(OTI5E7)
NBP2-45861
Flow Cytometry MIPEP Antibody (OTI5E7)
Immunofluorescence MIPEP Antibody (OTI5E7)
Immunohistochemistry MIPEP Antibody (OTI5E7)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Aquaporin-0
Antibody - BSA Free
NBP2-92773
Immunohistochemistry-Paraffin Aquaporin-0 Antibody - BSA Free
Immunohistochemistry-Paraffin Aquaporin-0 Antibody - BSA Free
Western Blot Aquaporin-0 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Transportin 1
Antibody (D45) - BSA
NB600-1397
Western Blot Transportin 1 Antibody (D45) - BSA Free
Western Blot Transportin 1 Antibody (D45) - BSA Free
Immunohistochemistry-Paraffin Transportin 1 Antibody (D45) - BSA Free
(1 Review)
(8 Publications)
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Cyclophilin-F
Antibody
NBP2-15079
Western Blot Cyclophilin-F Antibody
Immunocytochemistry/ Immunofluorescence Cyclophilin-F Antibody
Immunohistochemistry-Paraffin Cyclophilin-F Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
FKBP14 Antibody
H00055033-B01P
Western Blot FKBP14 Antibody
Western Blot FKBP14 Antibody
(3 Publications)
Species: Hu
Applications: WB
PPIL4 Recombinant
Protein Antigen
NBP1-85921PEP
PPIL4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PPIL4 Protein (NBP1-85921PEP) (0)

There are no publications for PPIL4 Protein (NBP1-85921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL4 Protein (NBP1-85921PEP) (0)

There are no reviews for PPIL4 Protein (NBP1-85921PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPIL4 Protein (NBP1-85921PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPIL4 Products

Blogs on PPIL4

There are no specific blogs for PPIL4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Human lung cancer cell line usig lysates from HCC44 cell line. (N: Nuclear fraction, C: Cytoplasmic fraction). Image from verified customer review.
Transportin 1 Antibody (D45) - BSA Free
NB600-1397

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPIL4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPIL4