Novus Biologicals products are now on bio-techne.com

PP2C beta/PPM1B Recombinant Protein Antigen

Images

 
There are currently no images for PP2C beta/PPM1B Protein (NBP1-87250PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

PP2C beta/PPM1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1B.

Source: E. coli

Amino Acid Sequence: KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87250.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PP2C beta/PPM1B Recombinant Protein Antigen

  • EC 3.1.3.16
  • MGC21657
  • PP2C beta
  • Pp2c2
  • PP2CB
  • PP2C-beta
  • PP2C-beta-X
  • PP2CBmagnesium-dependent, beta isoform
  • PPM1B
  • protein phosphatase 1B
  • Protein phosphatase 2C isoform beta
  • protein phosphatase 2C-like protein
  • protein phosphatase, Mg2+/Mn2+ dependent, 1B

Background

PPM1B is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB41051
Species: Hu, Mu
Applications: IHC, WB
NBP1-32751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93305
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NBP2-47272
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-57496
Species: Hu
Applications: ICC/IF
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-01859
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
201-LB
Species: Hu
Applications: BA

Publications for PP2C beta/PPM1B Protein (NBP1-87250PEP) (0)

There are no publications for PP2C beta/PPM1B Protein (NBP1-87250PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C beta/PPM1B Protein (NBP1-87250PEP) (0)

There are no reviews for PP2C beta/PPM1B Protein (NBP1-87250PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP2C beta/PPM1B Protein (NBP1-87250PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP2C beta/PPM1B Products

Research Areas for PP2C beta/PPM1B Protein (NBP1-87250PEP)

Find related products by research area.

Blogs on PP2C beta/PPM1B

There are no specific blogs for PP2C beta/PPM1B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP2C beta/PPM1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1B